DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk7

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:188 Identity:42/188 - (22%)
Similarity:75/188 - (39%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAP-------QDISKSAAIAKSREDCLR 118
            ||:....:||.|:..     ||.:|   ||.::...||.|       |..::.|:.......||.
Mouse     3 SLKPWARYLLLLMAH-----LLAMG---LGAVVLQALEGPPARHLQAQVQAELASFQAEHRACLP 59

  Fly   119 ELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGY 183
            .                     |.|....|:::.|...|                 .|:||    
Mouse    60 P---------------------EALEELLGAVLRAQAHG-----------------VSSLG---- 82

  Fly   184 DAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSL 241
            ::.::.:|....|||::.:::||.|:|.:.|.::.||...:.||.:|:|..|..:::|
Mouse    83 NSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKAFCVVYAALGLPASLALVAAL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 17/51 (33%)
Ion_trans_2 822..896 CDD:285168
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 16/50 (32%)
Ion_trans_2 178..>225 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7175
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.