DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk5

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_067517.1 Gene:Kcnk5 / 16529 MGIID:1336175 Length:502 Species:Mus musculus


Alignment Length:168 Identity:50/168 - (29%)
Similarity:80/168 - (47%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PGLVLLVIGYSVLGGLLFPLLEAP--QDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLV 139
            |.|...:|.|..:|..:|.:||.|  ::..|:               ..|:||::|.|  :..|.
Mouse     6 PLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKN---------------YYTQKLHLLKE--FPCLS 53

  Fly   140 HEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVI 204
            .|.|.:....:..|..||.|.:    |...|:                  :|::..|::::.|||
Mouse    54 QEGLDKILQVVSDAADQGVAIT----GNQTFN------------------NWNWPNAMIFAATVI 96

  Fly   205 TTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242
            ||||:|::.|:|.||:|..:||.|.||||.|..:|:||
Mouse    97 TTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 26/52 (50%)
Ion_trans_2 822..896 CDD:285168
Kcnk5NP_067517.1 Ion_trans_2 <81..137 CDD:285168 26/72 (36%)
Ion_trans_2 171..243 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.