DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk1

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_032456.2 Gene:Kcnk1 / 16525 MGIID:109322 Length:336 Species:Mus musculus


Alignment Length:209 Identity:52/209 - (24%)
Similarity:83/209 - (39%) Gaps:59/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGGVGGAGCGSEMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLE 98
            |..:.|:.|         ..|..:.||:.  |.|.          |||..:.|.|.|.::|..:|
Mouse     2 LQSLAGSSC---------VRLVERHRSAW--CFGF----------LVLGYLLYLVFGAVVFSSVE 45

  Fly    99 APQDISKSAAIAKSREDCLR-ELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSS 162
            .|.            ||.|| ||    .||...:......|...||.:|.|.::.|:..|.:..|
Mouse    46 LPY------------EDLLRQEL----RKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLS 94

  Fly   163 GGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYA 227
            ...|                     :.:|.|:.||.::.||::|.|:|...|.:..||...|.|:
Mouse    95 NASG---------------------NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYS 138

  Fly   228 LVGVPLMLMCLSSL 241
            ::|:|..|:.|:::
Mouse   139 VIGIPFTLLFLTAV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 18/51 (35%)
Ion_trans_2 822..896 CDD:285168
Kcnk1NP_032456.2 Ion_trans_2 <100..157 CDD:285168 18/53 (34%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:O00180 117..122 2/4 (50%)
Ion_trans_2 191..267 CDD:285168
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:O00180 225..230
Important for intracellular retention in recycling endosomes. /evidence=ECO:0000250|UniProtKB:O00180 293..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10523
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4619
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.