DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcna3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_032444.2 Gene:Kcna3 / 16491 MGIID:96660 Length:528 Species:Mus musculus


Alignment Length:109 Identity:30/109 - (27%)
Similarity:47/109 - (43%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 DAGDSQSW--SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVG-------VPLMLMCLS 239
            :|.|..|.  |..:|..::|..:||:|:|.:.|.|..||:.....|:.|       ||:::...:
Mouse   373 EADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFN 437

  Fly   240 SLGALLADG---LQCTYVRLCCQLQRHQEHRRKSTPGTSTPSAS 280
            .......:|   .|..:|..|..|....|..||:. ..||.|.|
Mouse   438 YFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKAR-SNSTLSKS 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 18/71 (25%)
Ion_trans_2 822..896 CDD:462301
Kcna3NP_032444.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
BTB_POZ 57..183 CDD:453885
Ion_trans 186..443 CDD:459842 18/69 (26%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 397..402 2/4 (50%)
Interaction with KCNE4. /evidence=ECO:0000250|UniProtKB:P15384 435..528 12/47 (26%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15384 526..528
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.