DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk15

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_570826.1 Gene:Kcnk15 / 156873 RGDID:619733 Length:318 Species:Rattus norvegicus


Alignment Length:189 Identity:50/189 - (26%)
Similarity:83/189 - (43%) Gaps:47/189 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|:|.::.|.::|..:|..||:..:.|:...:|:.|.:..|:.                    
  Rat     8 TAALILCILSYLLVGAAVFDALESEAERSRQRLLARKRGEFRRKY-------------------- 52

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
                ||                   .|..:.|....||....:.||  :.|.|:.:..:::||||
  Rat    53 ----RF-------------------SADDYRELERLALQAEPHRAG--RQWRFAGSFYFAITVIT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYV--RLCCQLQR 262
            |||:|...|.|.:||:..:||||:|:||.|:...|||..|...::|..:  :.|..|:|
  Rat    93 TIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNALVRCLLLAAKRCLGLRR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 30/69 (43%)
Ion_trans_2 822..896 CDD:462301
Kcnk15NP_570826.1 Ion_trans_2 <73..132 CDD:462301 27/60 (45%)
Ion_trans_2 <184..243 CDD:462301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..318
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.