DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Task6

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_320609.5 Gene:Task6 / 1280744 VectorBaseID:AGAMI1_014941 Length:385 Species:Anopheles gambiae


Alignment Length:167 Identity:40/167 - (23%)
Similarity:67/167 - (40%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|::....|.::|..:|..||:..:..:..|::......:....|.:|...|:          
Mosquito     8 TISLIVCTFTYLLIGAAVFDALESETEKKRWKALSAIENVLITRYNISSEDFKVI---------- 62

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
                   .:::..:....||                            |.|.||.|..|:.||:|
Mosquito    63 -------ETVIMKSEPHKAG----------------------------QQWKFSGAFYYATTVLT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242
            |||:|..||.|.:||:.|:.||.:|:||.|:...|:|
Mosquito    93 TIGYGHSTPTTVSGKIFTMCYAAIGIPLGLVMFQSIG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 27/66 (41%)
Ion_trans_2 822..896 CDD:462301
Task6XP_320609.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.