DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Task7

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_061497724.1 Gene:Task7 / 1273494 VectorBaseID:AGAMI1_012781 Length:339 Species:Anopheles gambiae


Alignment Length:112 Identity:37/112 - (33%)
Similarity:57/112 - (50%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 CREAEDSEEEDEKADGRQVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGD 861
            |::.|.:|.....|.|         |:.:..|..|..:|:.:|.||..|..|:|||||:|||:||
Mosquito   149 CQQTEATEMNLMLATG---------LLSSVIITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGD 204

  Fly   862 FVPARS----FNGP---ELQLYACCAYLLLGLVLVAMSFSILETQLM 901
            :|..::    .|.|   .|.|    .::|.||.:||.|.::|..:.|
Mosquito   205 YVALQNDQALINKPGYVALSL----VFILFGLAVVAASINLLVLRFM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 30/80 (38%)
Task7XP_061497724.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.