DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnc3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_446449.2 Gene:Kcnc3 / 117101 RGDID:621358 Length:769 Species:Rattus norvegicus


Alignment Length:127 Identity:37/127 - (29%)
Similarity:49/127 - (38%) Gaps:26/127 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 AKPLPQEINALMDCGTGSPDLSGRHDLLPPPHSGSPATGTAASPLLTYTAAATSPQLSAGIKGGS 611
            ::|.|          |..|..|....|||||.......||||||       |.:| ||.| .||.
  Rat    21 SQPAP----------TPQPPESSPPPLLPPPQQQCAQPGTAASP-------AGAP-LSCG-PGGR 66

  Fly   612 GPAPTAGAPMLVSGAGRGAAALTDNGFMAAGVCGM-----GAAAAPLPVTSMGAATTTASSA 668
            ...|.:|.|.:..|...|...  |:|.:...|.|:     .:....||.|.:...|...::|
  Rat    67 RAEPCSGLPAVAMGRHGGGGG--DSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301
Kcnc3NP_446449.2 BTB_KCNC1_3 91..204 CDD:349721 7/36 (19%)
Ion_trans 290..551 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.