DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk6

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:157 Identity:47/157 - (29%)
Similarity:71/157 - (45%) Gaps:33/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLREL-WIITEKLNVLYERNWTMLVHEQLRRFEG 148
            ||..||.||...||.|.:....|.:...||..||.. .:....|:...||               
  Rat    16 GYLALGALLVARLERPHEARLRAELGTLREQLLRHSPCVAAHALDAFVER--------------- 65

  Fly   149 SIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLT 213
             ::||.|.|.|..:...|..               :|.| .:|.|:.||.::.|::||:|:|..|
  Rat    66 -VLAAGRLGRAVLANASGPA---------------NASD-PAWDFASALFFASTLVTTVGYGYTT 113

  Fly   214 PRTAAGKLATIFYALVGVPLMLMCLSS 240
            |.|.|||..:|.:||:|||:.::.|::
  Rat   114 PLTDAGKAFSIVFALLGVPITMLLLTA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 22/50 (44%)
Ion_trans_2 822..896 CDD:285168
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 22/50 (44%)
Ion_trans_2 180..259 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10303
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.