DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk4

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_006230696.1 Gene:Kcnk4 / 116489 RGDID:621449 Length:423 Species:Rattus norvegicus


Alignment Length:213 Identity:60/213 - (28%)
Similarity:90/213 - (42%) Gaps:55/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GAGCGSEMG-AKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQD 102
            |:|.|...| |..:.:|.|                      |:.||:.|.|.|.|:|..||.|.:
  Rat    16 GSGAGPAPGRAMRSTTLLA----------------------LLALVLLYLVSGALVFQALEQPHE 58

  Fly   103 ISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGA 167
            ......:...|:..|::...:::| |:   ..:..||.|.|                    ||||
  Rat    59 QQVQKDLEDGRDQFLKDHPCVSQK-NL---EGFIKLVAEAL--------------------GGGA 99

  Fly   168 GLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
            ......:.|        :..|.:|:...|..:|.|:|||||:|::...|.||:|..|||||||:|
  Rat   100 NPETSWTNS--------SNHSSAWNLGSAFFFSGTIITTIGYGNIALHTDAGRLFCIFYALVGIP 156

  Fly   233 LMLMCLSSLGALLADGLQ 250
            |..|.|:.:|..|...|:
  Rat   157 LFGMLLAGVGDRLGSSLR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 27/55 (49%)
Ion_trans_2 822..896 CDD:285168
Kcnk4XP_006230696.1 Ion_trans_2 <115..169 CDD:285168 26/53 (49%)
Ion_trans_2 207..285 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.