DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK7

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:172 Identity:39/172 - (22%)
Similarity:68/172 - (39%) Gaps:42/172 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FSTPGLV----LLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERN 134
            :|..||:    ||.:|   ||.::|..||.|......|.              :..:|......:
Human     7 WSRYGLLVVAHLLALG---LGAVVFQALEGPPACRLQAE--------------LRAELAAFQAEH 54

  Fly   135 WTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLY 199
            ...|....|....|:.:|....|                 .|.||    ::.:.::|....|||:
Human    55 RACLPPGALEELLGTALATQAHG-----------------VSTLG----NSSEGRTWDLPSALLF 98

  Fly   200 SVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSL 241
            :.:::||.|:|.:.|.:..||...:.||.:|:|..|..:::|
Human    99 AASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASLALVATL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 17/51 (33%)
Ion_trans_2 822..896 CDD:285168
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 16/49 (33%)
Ion_trans_2 182..>220 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4753
Isobase 1 0.950 - 0 Normalized mean entropy S7175
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.