DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcna10

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_002938481.1 Gene:kcna10 / 100497698 XenbaseID:XB-GENE-991589 Length:499 Species:Xenopus tropicalis


Alignment Length:66 Identity:21/66 - (31%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVG 230
            |..||    :||:.....|...||..|..:...::|..:||:|:|.:.|.|.:||:.....|:.|
 Frog   372 GVILF----SSAVYFAEVDEPQSQFLSIPDGFWWAVVTMTTVGYGDMCPITLSGKVVGTLCAIAG 432

  Fly   231 V 231
            |
 Frog   433 V 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 17/55 (31%)
Ion_trans_2 822..896 CDD:462301
kcna10XP_002938481.1 BTB_POZ 74..200 CDD:453885
Ion_trans 252..454 CDD:459842 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.