DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and XB5727110

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_031747981.1 Gene:XB5727110 / 100486031 XenbaseID:XB-GENE-5727111 Length:318 Species:Xenopus tropicalis


Alignment Length:187 Identity:49/187 - (26%)
Similarity:83/187 - (44%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQL 143
            |.:..:.|.::|.|:|.:||            |..||..:   ..||:..:.:.:|:|.|..|.|
 Frog    12 LAMAFMVYLLVGALVFQVLE------------KEAEDTAK---TDTERHRLDFLKNYTCLTKEAL 61

  Fly   144 RRFEGSIVAATRQGSAGSSGGGGAGLFH--EGSASALGHFGYDAGDSQSWSFSEALLYSVTVITT 206
            ......|..|.:||            .|  |....         ....:|..|.:..::.||:||
 Frog    62 DHLVNVITDAVKQG------------IHPLENQTK---------NSHSNWDMSSSFFFAGTVVTT 105

  Fly   207 IGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRH 263
            ||:|:|:|||..|::..:.|||.|:||.::.|..:|.:|:        |:|.:|.::
 Frog   106 IGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILS--------RVCHRLGQY 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/55 (42%)
Ion_trans_2 822..896 CDD:285168
XB5727110XP_031747981.1 Ion_trans_2 86..146 CDD:400301 23/67 (34%)
Ion_trans_2 178..245 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.