DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and si:dkey-43k4.5

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:XP_021332757.1 Gene:si:dkey-43k4.5 / 100148290 ZFINID:ZDB-GENE-120215-82 Length:487 Species:Danio rerio


Alignment Length:84 Identity:26/84 - (30%)
Similarity:41/84 - (48%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 ILASYICVGTVIFA----LWENWSLV--DGAYFCF----VTLSTIGYGDFVPARSFNGPELQLYA 877
            ||..|:.||..:|:    ..||...|  |....|:    |:::|:||||.||...  ..:|....
Zfish   330 ILLLYLAVGVSVFSGMAYTAENEEDVGLDTIPACWWWGTVSMTTVGYGDVVPVTV--AGKLAASG 392

  Fly   878 CCAYLLLGLVLVAMSFSIL 896
            |   :|.|.::||:..:|:
Zfish   393 C---ILGGTLVVALPITII 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 25/82 (30%)
si:dkey-43k4.5XP_021332757.1 BTB_POZ 18..122 CDD:453885
Ion_trans 185..420 CDD:459842 26/84 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.