DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB41 and br

DIOPT Version :9

Sequence 1:NP_919290.2 Gene:ZBTB41 / 360023 HGNCID:24819 Length:909 Species:Homo sapiens
Sequence 2:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster


Alignment Length:882 Identity:155/882 - (17%)
Similarity:251/882 - (28%) Gaps:302/882 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    77 LNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKNP-STDVVTLDHVTHSVFQHLL 140
            |.||.    :|.|:.:..||:...||:||::..|.||...|...| ...|:.|..|.......|:
  Fly    25 LRDDE----AFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPVILLQDVNFMDLHALV 85

Human   141 EFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVAPFHSELTE-----KSSPEETLNELT 200
            ||:|..|..|::..:...|:.|:.|    .|..|..:.....||.|.:     .|.....||..|
  Fly    86 EFIYHGEVNVHQKSLQSFLKTAEVL----RVSGLTQQQAEDTHSHLAQIQNLANSGGRTPLNTHT 146

Human   201 GRLSNNHQCKF-----CSRHFCYK----------KSLENH--------LAKTHRSLLLG----KK 238
            ..|.:.|....     .|..|..:          .||.:|        :|..|||....    ..
  Fly   147 QSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETS 211

Human   239 HGLKMLERS-------------------------------------FSARRSKRNRKCPVKFDD- 265
            |..|.|..|                                     ||..:...|...|...:: 
  Fly   212 HAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEK 276

Human   266 ----TSDDEQESGDGSDNLNQENFDKEKSDRNDSEDPGSEYNAEEDELEEE------------MS 314
                |.:....:|:|:.|..........||:..|..|.....|..|:::.|            .:
  Fly   277 RNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANAN 341

Human   315 DEYSDIEEQSEKDHN------------DAEEEPEAGDSVGNVH---------------------- 345
            ||:|: :...|.|.|            .:..:.|.||.:.:.|                      
  Fly   342 DEHSN-DSTGEHDANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNF 405

Human   346 EGLTPVVIQNSNKKILQ------CPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNL 404
            ..:.|..:...|.::.|      .|:...|    |...|...|..|..           .|.||.
  Fly   406 PNIDPSALLGLNTQLQQSGDLAVSPQGGST----GSLLSGVIVPGGSG-----------GTPSNS 455

Human   405 TVHRKKHSNETEFHKKE-------------HKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIK 456
            :.:...:::..:..|.|             |..|:.|.                |:..||     
  Fly   456 SSNNNNNNSNNQQQKVEQQSSPHQLLQQQHHSTPHTNS----------------PQLKQE----- 499

Human   457 KTKSESWKC---DI-----CKKSFTR----RPHLEEH-------MILHSQDKPFKCTYCEEHFKS 502
            :.||....|   |:     .::|.:|    .|....|       ...|.:::..:.....|..:.
  Fly   500 QPKSGGGSCKSSDLHIAAGSERSLSRSSQGMPDAGGHSATPSPTAAYHKRERERERERERERERE 564

Human   503 RFARLKHQEKF------------------HLGPFPCDICGRQFNDTGNLKRHIECTHGGKRKWTC 549
            |...|.|:...                  |.|..|..:                           
  Fly   565 RERSLDHERDLERPGGTGSPPPPPPSHHSHFGQHPLSL--------------------------- 602

Human   550 FICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDKRYECDECGKTFIR 614
                        |..|.::|:..  |..|.......|..::..|        .:.....|.. :.
  Fly   603 ------------LPSHHQLHATH--HELSAAAAHHAHAHAHAAH--------AHALARAGSP-ME 644

Human   615 HDHLTKHKKIH---SGEKAHQCEECGKCFGRRDH--------LTVHYKSVHLGEKVWQKYKA-TF 667
            |.||..|::..   ||..:......|:..|....        .:|..:.|....::...... ..
  Fly   645 HHHLLHHRRASLSPSGAVSSASGAGGRGGGAGGPGGPGGSLLSSVRAQDVAQANRLLLPLPLNAC 709

Human   668 HQCDVCKKIFKGKSSLEMHFRTHSGEKPYK---CQICNQSFRIKKTLTKHLVIHSDARPFNCQHC 729
            |:||||.|:...|.:|:.| :.....:|..   |.:|::.||...:|..|..|:           
  Fly   710 HRCDVCGKLLSTKLTLKRH-KEQQHLQPLNNAVCNLCHKVFRTLNSLNNHKSIY----------- 762

Human   730 NATFKRKDKLKYHIDHVHEIKSPDDPLSTSEEKLVSL 766
               .:|:.....:..|...:.....|.|...:.|.||
  Fly   763 ---HRRQKNHHSYFHHGAGVSQAGSPGSRLHQSLSSL 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB41NP_919290.2 BTB_POZ_ZBTB41 66..179 CDD:349535 30/102 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..344 22/120 (18%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
C2H2 Zn finger 391..411 CDD:275368 3/19 (16%)
C2H2 Zn finger 424..442 CDD:275368 2/17 (12%)
C2H2 Zn finger 465..485 CDD:275368 6/38 (16%)
C2H2 Zn finger 493..510 CDD:275368 3/16 (19%)
C2H2 Zn finger 520..541 CDD:275368 0/20 (0%)
C2H2 Zn finger 549..569 CDD:275368 2/19 (11%)
C2H2 Zn finger 577..597 CDD:275368 3/19 (16%)
zf-C2H2 603..625 CDD:395048 5/21 (24%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 633..651 CDD:275368 3/25 (12%)
C2H2 Zn finger 670..687 CDD:275368 7/16 (44%)
C2H2 Zn finger 698..718 CDD:275368 6/19 (32%)
C2H2 Zn finger 726..743 CDD:275368 1/16 (6%)
brNP_001162638.2 BTB 22..118 CDD:279045 30/100 (30%)
BTB 33..118 CDD:197585 26/88 (30%)
C2H2 Zn finger 712..729 CDD:275368 8/17 (47%)
C2H2 Zn finger 742..763 CDD:275368 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.