DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and STK17A

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_004751.2 Gene:STK17A / 9263 HGNCID:11395 Length:414 Species:Homo sapiens


Alignment Length:337 Identity:122/337 - (36%)
Similarity:190/337 - (56%) Gaps:24/337 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSL-------QHHLIIQLYA 96
            |:|||||..|.||..|.:|.:.||||:    |:.::..:..:||::.:       .:..:|.|:.
Human    66 ELGRGKFAVVRKCIKKDSGKEFAAKFM----RKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHE 126

  Fly    97 AYEYQKMMCVVLELIEGGELFDR-VVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPEN 160
            .||....|.:|||...|||:||: |.|.|....|:..:..:||:.|.:.|:|...:|||||||:|
Human   127 VYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQN 191

  Fly   161 ILVLTQK--GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYV 223
            ||:.::.  |: |||:||||:|.....:.||.:.||||:||||::::|.||..|||||:||:.||
Human   192 ILLTSESPLGD-IKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYV 255

  Fly   224 LISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKW 288
            :::|:|||:|.:..||..|::.....:.:|.|:.:|...:|||..||.|....|.||.||:||.|
Human   256 MLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPW 320

  Fly   289 LQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQ-----QA 348
            |.|    ::...|..:...|..::.............|..|.:||.|....||.:.|.     |.
Human   321 LTQ----SSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQC 381

  Fly   349 KQKDQQQDEELA 360
            :|.::::.|:.|
Human   382 RQSEKEKMEQKA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 105/259 (41%)
STKc_MLCK 40..289 CDD:271005 104/258 (40%)
STK17ANP_004751.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
STKc_DRAK1 51..321 CDD:271099 105/259 (41%)
S_TKc 64..321 CDD:214567 105/259 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.