DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and STK17B

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens


Alignment Length:352 Identity:122/352 - (34%)
Similarity:190/352 - (53%) Gaps:56/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHL-----------II 92
            |:|||||..|.:|..|:.|.:.||||:    ::.:|..:...||:    |.:           :|
Human    38 ELGRGKFAVVRQCISKSTGQEYAAKFL----KKRRRGQDCRAEIL----HEIAVLELAKSCPRVI 94

  Fly    93 QLYAAYEYQKMMCVVLELIEGGELFDRVVDD--EFVLTERVCRVFIRQVCEAMAFIHGNGIVHLD 155
            .|:..||....:.::||...|||:|...:.:  |.|....|.|: |:|:.|.:.::|.|.|||||
Human    95 NLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRL-IKQILEGVYYLHQNNIVHLD 158

  Fly   156 LKPENILV--LTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVG 218
            |||:|||:  :...|: |||:|||::||......||.:.||||::|||::|:|.|:..||||::|
Human   159 LKPQNILLSSIYPLGD-IKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIG 222

  Fly   219 VICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAEC 283
            :|.|:|::..|||:||::.||..|::....|:.:|.|:.:|....|||..||.|:...|.||..|
Human   223 IIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEIC 287

  Fly   284 MKHKWLQQ-------RPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTE------TIE 335
            :.|.||||       .|          :..|::|:::..||       .||||.|.      |..
Human   288 LSHSWLQQWDFENLFHP----------EETSSSSQTQDHSV-------RSSEDKTSKSSCNGTCG 335

  Fly   336 DEDDEEEVAVQQAK-QKDQQQDEELAN 361
            |.:|:|.:....:. .|..:.|:.|.|
Human   336 DREDKENIPEDSSMVSKRFRFDDSLPN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 100/264 (38%)
STKc_MLCK 40..289 CDD:271005 99/263 (38%)
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 100/264 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.