DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and DCLK1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001317000.1 Gene:DCLK1 / 9201 HGNCID:2700 Length:740 Species:Homo sapiens


Alignment Length:376 Identity:102/376 - (27%)
Similarity:171/376 - (45%) Gaps:56/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDSEPEGVLEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK 69
            :|...|.|.|..|.: ..||.      :.|.|...:|.|.|..|.:|.:::...:.|.|.:...|
Human   368 NDGPGEEVSEEGFQI-PATIT------ERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSK 425

  Fly    70 REDKRN-VEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCR 133
            ...|.: ::.||.|:..::|..|:.|....:....:.:|:||::||:|||.:.... ..|||...
Human   426 CRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTN-KYTERDAS 489

  Fly   134 VFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNR-IKIIDFGLARKFDPDKRLRVLFGTPE 196
            ..:..:..|:.::|...|||.|:||||:||.. |.|:: :|:.|||||...|..  |..:.|||.
Human   490 GMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGP--LYTVCGTPT 552

  Fly   197 FVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETM--SNVTIAKYDFEDECFNGIS 259
            :||||::.........|:|:.|||.|:|:.|..||.|..|.:.:  ..:.:.:.||....::.:|
Human   553 YVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVS 617

  Fly   260 PECLDFIAKLLAKDLSTRMTAAECMKHKWLQQ----------------------RPATAATATPI 302
            ....:.|..:|..|:..|.:|.:.::|.|:..                      .|...:||..:
Human   618 DSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGV 682

  Fly   303 TKAASAA---------------SKSRLKS-VSPVTAPSES---SEDSTETI 334
            :..|:.|               .:||.|: .:|....|||   |..|:||:
Human   683 SVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETV 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 78/259 (30%)
STKc_MLCK 40..289 CDD:271005 76/253 (30%)
DCLK1NP_001317000.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..378 3/9 (33%)
STKc_DCKL1 383..650 CDD:271085 81/275 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..740 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.