DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and PSKH2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_016869418.1 Gene:PSKH2 / 85481 HGNCID:18997 Length:504 Species:Homo sapiens


Alignment Length:302 Identity:95/302 - (31%)
Similarity:154/302 - (50%) Gaps:8/302 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYA 96
            :.||:...:|.|.|..|.:...|......|.|.:...:||.:.....|:.::..:.|..|:||..
Human   180 RRYDIKALIGTGSFSRVVRVEQKTTKKPFAIKVMETREREGREACVSELSVLRRVSHRYIVQLME 244

  Fly    97 AYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENI 161
            .:|.:..:.:|:||..|||||||:: .:...|||.....::.|.:.:.::|...|.|.:|||||:
Human   245 IFETEDQVYMVMELATGGELFDRLI-AQGSFTERDAVRILQMVADGIRYLHALQITHRNLKPENL 308

  Fly   162 LVL-TQKGNRIKIIDFGLA--RKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYV 223
            |.. ..:.::|.|.|||||  .|...|..::.|.||||::||||:.....:...|||::|||.|.
Human   309 LYYHPGEESKILITDFGLAYSGKKSGDWTMKTLCGTPEYIAPEVLLRKPYTSAVDMWALGVITYA 373

  Fly   224 LISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKW 288
            |:||..||..|:.......:...||::..|.:..||....|||.|||..:...||:|.:.:.|.|
Human   374 LLSGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPW 438

  Fly   289 LQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDS 330
            :    .|.|..:.:.....|.|::.::..||.:....|::.|
Human   439 V----ITMAAGSSMKNLQRAISRNLMQRASPHSQSPGSAQSS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 86/257 (33%)
STKc_MLCK 40..289 CDD:271005 84/251 (33%)
PSKH2XP_016869418.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.