DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and MEK1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:90/324 - (27%)
Similarity:164/324 - (50%) Gaps:46/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIYIDDSEPEGVLEPAFPMRDVTINRNVDAHKHYDVLGE-VGRGKFGTVY-----KCRDK---AN 56
            ::::.:.:.:..|:|.. :..:...|.||   .:::... ||.|.||.|.     |.||:   .:
Yeast   132 LVFMINDDLQSSLDPKL-LDQMGFLREVD---QWEITNRIVGNGTFGHVLITHNSKERDEDVCYH 192

  Fly    57 GLQLAAKFVPI-PKREDKRNVEREVEIMNSLQHHLIIQLYAAY-EYQKMMCVVLELIEGGELFDR 119
            ....|.|.:.: |.:.||     |..|:..|.|..||::|..: :....:.:..:||.||:||..
Yeast   193 PENYAVKIIKLKPNKFDK-----EARILLRLDHPNIIKVYHTFCDRNNHLYIFQDLIPGGDLFSY 252

  Fly   120 VVDDEFVL----TERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLA 179
            :...:.:.    ||.:..||  |:.:|:.::|...|||.|||.:|||:.| :...||.:.|||:|
Yeast   253 LAKGDCLTSMSETESLLIVF--QILQALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIA 315

  Fly   180 RKFDPDK-RLRVLFGTPEFVAPEV---------------VNFDCISYGT--DMWSVGVICYVLIS 226
            :..:.:| |:..:.||||:.||||               ...:...|.:  |:||:|||.:::::
Yeast   316 KDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQRGYDSKCDLWSLGVITHIMLT 380

  Fly   227 GLSPFMGE-NDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289
            |:|||.|: ::...:.|..|.|.:|:.:.::.:|.....|:..||..|:..|:.:.:.:||.|:
Yeast   381 GISPFYGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQTDVVKRLNSKQGLKHIWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 84/289 (29%)
STKc_MLCK 40..289 CDD:271005 84/282 (30%)
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 84/289 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.