DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and CMK2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_014626.1 Gene:CMK2 / 854144 SGDID:S000005376 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:100/400 - (25%)
Similarity:177/400 - (44%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVE-----REVEIMNSLQHHLIIQLYAAYE 99
            :|.|.||.|.:.|..:....:|.|.: :.|.....||:     .|:.|:..|.|..|:.....:|
Yeast    53 LGAGSFGVVRQARKLSTNEDVAIKIL-LKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFE 116

  Fly   100 YQKMMCVVLELIEGGELFDRVVD-DEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILV 163
            .:....:|.:|..|||||||::. .:|...:.|  ..|.|:..|:.::|...:||.||||||:|.
Yeast   117 SKDKFYIVTQLATGGELFDRILSRGKFTEVDAV--EIIVQILGAVEYMHSKNVVHRDLKPENVLY 179

  Fly   164 LTQKGNR-IKIIDFGLARKFDPDKRLRVLF---GTPEFVAPEVVNFDCISYGTDMWSVGVICYVL 224
            :.:..|. :.|.|||:|::...::.|  ::   |:..:|||||:..|......|:||:|||.|.|
Yeast   180 VDKSENSPLVIADFGIAKQLKGEEDL--IYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTL 242

  Fly   225 ISGLSPFMGENDIETMSNVTIAKY--DFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHK 287
            :.|.|||:.|:....|...|.::|  .|....::.||.:...||.|.|..:.:.|.||.|.:...
Yeast   243 LCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDP 307

  Fly   288 WLQQRPATAATATPITKAASAASK------------SRLKSVSPVTAPSESSEDS---------- 330
            |:..:....:...|..|...:..|            :|:|.:..:.:..:..::.          
Yeast   308 WITSKRVETSNILPDVKKGFSLRKKLRDAIEIVKLNNRIKRLRNMYSLGDDGDNDIEENSLNESL 372

  Fly   331 ----TETIED----------EDDEEEVAVQQAKQKD-------------------QQQDEELANL 362
                |.:::|          |..||::.::.|..||                   :::|:....|
Yeast   373 LDGVTHSLDDLRLQSQKKGGELTEEQMKLKSALTKDAFVQIVKAATKNKHKVLAGEEEDDSKKTL 437

  Fly   363 CGDAELENKE 372
            ..|.|.::::
Yeast   438 HDDRESKSED 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 82/260 (32%)
STKc_MLCK 40..289 CDD:271005 82/260 (32%)
CMK2NP_014626.1 STKc_CAMK 46..308 CDD:270687 82/259 (32%)
S_TKc 47..309 CDD:214567 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.