DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and MYLK2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_149109.1 Gene:MYLK2 / 85366 HGNCID:16243 Length:596 Species:Homo sapiens


Alignment Length:315 Identity:145/315 - (46%)
Similarity:206/315 - (65%) Gaps:17/315 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDDSEPEGVLEPA-FPMRDVTINR-NVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVP 66
            :||..|    .|| ||.|.|.:.. ||.:....:....:|.||||.|..|.:||.||:||||.:.
Human   257 LDDCPP----PPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCTCMEKATGLKLAAKVIK 317

  Fly    67 IPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERV 131
            ....:||..|..|:|:||.|.|..:||||||.|....:.:.:|.|||||||:|:||:::.|||..
Human   318 KQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVD 382

  Fly   132 CRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPE 196
            ..||:||:|:.:.|:|...::||||||||||.:...|:.:|||||||||:::|:::|:|.|||||
Human   383 TMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPE 447

  Fly   197 FVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPE 261
            |::|||||:|.||..|||||:|||.|:|:||||||:|::|.||::||....:.|::|.|..:|.|
Human   448 FLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDE 512

  Fly   262 CLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKS 316
            ..||::.|:.||...||.||:|:.|.||..          :.:.|...:: ||||
Human   513 AKDFVSNLIVKDQRARMNAAQCLAHPWLNN----------LAEKAKRCNR-RLKS 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 127/254 (50%)
STKc_MLCK 40..289 CDD:271005 127/248 (51%)
MYLK2NP_149109.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..224
STKc_MLCK2 280..540 CDD:271092 127/259 (49%)
Calmodulin-binding. /evidence=ECO:0000250 574..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13223
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2697
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.