DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and IKS1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_012478.3 Gene:IKS1 / 853389 SGDID:S000003593 Length:667 Species:Saccharomyces cerevisiae


Alignment Length:441 Identity:86/441 - (19%)
Similarity:162/441 - (36%) Gaps:139/441 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KHYDVLGEVGRGKFGTVYKCRDKANGLQL---AAKFVPIPKREDKRN-VEREVEIMNSLQH---- 88
            |.:.:|..:|.|..|:|||........:|   |.|.:||....:..| ..|||:.::||.|    
Yeast   171 KFFKILSLLGNGARGSVYKVVHTIGNTELGVFALKKIPIGNDMEWFNKCIREVKALSSLTHKSAN 235

  Fly    89 -----HLIIQLYAAYEY------------QKMMCVVL--ELIEGGEL--------FDRVVDDEF- 125
                 |:.:::.::..:            :::.|:.:  :...||.|        |:|..|.|. 
Yeast   236 LITYNHVWLEMDSSVGFVRSIDGSQSDSQEEVPCIFILQQYCSGGNLEDCILRKVFNRFSDTESP 300

  Fly   126 ---------------------VLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT---- 165
                                 :.||::..: ||.:...:..:|..|::|.||||.|.|:||    
Yeast   301 EERKKKFRTRKKNHGKSGEVGLSTEQLVSI-IRDIARGLHELHSIGLIHRDLKPSNCLLLTPFKS 364

  Fly   166 --QKGN-------------RIKIIDFGLARKFDPDKRLRV-LFGTPEFVAPEVV----------- 203
              :..|             .|.|.|.| ..:.:.:.||.. ..||.||.||:::           
Yeast   365 DNENDNVYDREHNSDEFFPSIVIGDLG-ESQLEGESRLGTGCTGTLEFTAPDLIIQGRPVSSSTL 428

  Fly   204 ------NFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPEC 262
                  .::..::.:||:|:|:|||.::.|..||..:.||..: .|.|..:.|:           
Yeast   429 PSRSSHTYNEYTFASDMYSLGMICYFIVFGELPFEPQLDIVDL-KVRIKNFRFD----------- 481

  Fly   263 LDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESS 327
                            |.....||:.::.:|               ..:.....:..:..|:..:
Yeast   482 ----------------TEGMIEKHQAMKLKP---------------IDRRIFHLMDALLQPNNDA 515

  Fly   328 EDSTETIEDEDDEEEVAVQQAKQKDQQQDEELANLCGDAELENKELDATKD 378
            ..:.:|:|:..||..:..:..|:..::..:...|....:|:.......|.|
Yeast   516 RPTAKTVEETLDEMLINSKPGKKFWKENVDSTLNFSTISEVNENTNSFTDD 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 74/348 (21%)
STKc_MLCK 40..289 CDD:271005 73/342 (21%)
IKS1NP_012478.3 PKc_like 173..522 CDD:419665 76/393 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.