DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and RCK1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_011357.1 Gene:RCK1 / 852719 SGDID:S000003126 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:448 Identity:115/448 - (25%)
Similarity:185/448 - (41%) Gaps:112/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DVTINRNVD----AHKH--------YDVLGEVGRGKFGTVYKC-----RDKANGLQLAAKFV--- 65
            |.|.|::.|    .|::        |.:|.::|.|.|..|:|.     .|:|   .:|.|.:   
Yeast    96 DETSNKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQA---PVAIKAIIKK 157

  Fly    66 -----PIPKREDKRNVEREVEIMNSLQHHLII-------------QLYAAYEYQKMMCVVLELIE 112
                 .|.|..|:.......:::|.:..|.::             |..|.|.|     :|.||:.
Yeast   158 GISSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESANYYY-----LVTELVT 217

  Fly   113 GGELFDRVVDDEFVLT---ERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVL---------- 164
            |||:|||:|.    ||   |.:.|..|.||..|:..:|..||||.|:||||:|..          
Yeast   218 GGEIFDRIVQ----LTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGD 278

  Fly   165 TQKGNR------------IKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSV 217
            .||.:.            :|::|||||:|. .:...:...||.|:||.||......|...||||:
Yeast   279 MQKEDEFTLGVGGGGIGLVKLMDFGLAKKL-RNNTAKTPCGTIEYVASEVFTSKRYSMKVDMWSI 342

  Fly   218 GVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAE 282
            |.:.:.|:.|..||..:|:...:..::...|:|....::.||....:.:..||..|.:.|....:
Yeast   343 GCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDD 407

  Fly   283 CMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQQ 347
            .:...||        .:....|.:::.|.:.::|:.     ::|.::..||:..     .::.|.
Yeast   408 FLNDPWL--------NSYDCLKDSNSNSYASVQSIL-----NDSFDERAETLHC-----ALSCQS 454

  Fly   348 AKQKDQQ-----------QDEELANLCGDAELENKE---LDATKDNL----KNFIVRW 387
            .||.|.:           ..||..||.|....|.||   ||....::    ||.|..|
Yeast   455 EKQDDTEFSRSESSEYIFMTEEDRNLRGSWIGEPKECFTLDLATSSIYRRRKNKIFFW 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 84/305 (28%)
STKc_MLCK 40..289 CDD:271005 82/299 (27%)
RCK1NP_011357.1 STKc_RCK1-like 119..414 CDD:270998 84/307 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.