DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and RCK2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_013349.1 Gene:RCK2 / 850950 SGDID:S000004238 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:96/453 - (21%)
Similarity:178/453 - (39%) Gaps:86/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDSEPEGVLEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANG----LQLAAKFV 65
            |||..:..:|...|.:.....:.:..:|   ::.::|.|.|..|::.....|.    |....|.|
Yeast   137 DDSTDDDNMEDEIPEKSFLEQKELIGYK---LINKIGEGAFSKVFRAIPAKNSSNEFLTKNYKAV 198

  Fly    66 PI------------------PKREDKRNVEREVEIMNSLQHHLII-----QLYAAYEYQK---MM 104
            .|                  .|.:|........:::..:..|..:     |:.|..::|:   ..
Yeast   199 AIKVIKKADLSSINGDHRKKDKGKDSTKTSSRDQVLKEVALHKTVSAGCSQIVAFIDFQETDSYY 263

  Fly   105 CVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGN 169
            .::.||:.|||:|..:|...: .:|.:.|..|:|:..|:..:|..|:||.|:||||:|....:..
Yeast   264 YIIQELLTGGEIFGEIVRLTY-FSEDLSRHVIKQLALAVKHMHSLGVVHRDIKPENLLFEPIEFT 327

  Fly   170 R--------------------------------IKIIDFGLARKFDPDKRLRVLFGTPEFVAPEV 202
            |                                :|:.||||:::.. .|..:...||..:.||||
Yeast   328 RSIKPKLRKSDDPQTKADEGIFTPGVGGGGIGIVKLADFGLSKQIF-SKNTKTPCGTVGYTAPEV 391

  Fly   203 VNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMS-NVTIAKYDFEDECFNGISPECLDFI 266
            |..:..|...|||.:|.:.|.::.|..||..|. |:|:: .::..:|.|....::.||....:.:
Yeast   392 VKDEHYSMKVDMWGIGCVLYTMLCGFPPFYDEK-IDTLTEKISRGEYTFLKPWWDEISAGAKNAV 455

  Fly   267 AKLLAKDLSTRMTAAECMKHKWL-------------QQRPATAATATPITKAASAASKSRLKSVS 318
            ||||..:.|.|....:.:...||             |::..|:....|..|......:......|
Yeast   456 AKLLELEPSKRYDIDQFLDDPWLNTFDCLPKEGESSQKKAGTSERRHPHKKQFQLFQRDSSLLFS 520

  Fly   319 PVTAPSESSEDSTETIEDEDDEEEVAVQ---QAKQKDQQQDEELANLCGDAELENKELDATKD 378
            |.......:.|....:: ..:|:.:..:   .:..:|::.::..:...||.:||......|.|
Yeast   521 PAAVAMRDAFDIGNAVK-RTEEDRMGTRGGLGSLAEDEELEDSYSGAQGDEQLEQNMFQLTLD 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 73/317 (23%)
STKc_MLCK 40..289 CDD:271005 73/311 (23%)
RCK2NP_013349.1 STKc_RCK1-like 161..478 CDD:270998 74/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.