DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and OBSCN

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001373054.1 Gene:OBSCN / 84033 HGNCID:15719 Length:8925 Species:Homo sapiens


Alignment Length:817 Identity:204/817 - (24%)
Similarity:320/817 - (39%) Gaps:203/817 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DSEPEGVLEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKR 70
            |:||:...:          :.....|..|:|..|:|||.||.|.:.:.|.|.:..||||:|:..|
Human  7407 DNEPDSEKQ----------SHRRKLHSFYEVKEEIGRGVFGFVKRVQHKGNKILCAAKFIPLRSR 7461

  Fly    71 EDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVF 135
             .:....||.:|:.:|.|.|:..|...:|.:|.:.::|||....||.||:. .:.|:||...:|:
Human  7462 -TRAQAYRERDILAALSHPLVTGLLDQFETRKTLILILELCSSEELLDRLY-RKGVVTEAEVKVY 7524

  Fly   136 IRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAP 200
            |:|:.|.:.::|.:|::|||:||.|||::......|||.|||.|:...|.:.....:|:||||:|
Human  7525 IQQLVEGLHYLHSHGVLHLDIKPSNILMVHPAREDIKICDFGFAQNITPAELQFSQYGSPEFVSP 7589

  Fly   201 EVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDF 265
            |::..:.:|..:|:|::|||.|:.::..|||.||:|..|:.||...:..:.......:|.:..||
Human  7590 EIIQQNPVSEASDIWAMGVISYLSLTCSSPFAGESDRATLLNVLEGRVSWSSPMAAHLSEDAKDF 7654

  Fly   266 IAKLLAKDLSTRMTAAECMKHKW-LQQRPATAATATPITKAASAASKSR-------------LKS 316
            |...|.:....|.:||:|:.|.| |:..||..|......:.....::||             ::|
Human  7655 IKATLQRAPQARPSAAQCLSHPWFLKSMPAEEAHFINTKQLKFLLARSRWQRSLMSYKSILVMRS 7719

  Fly   317 V-----SPVTAPS-------------ESSEDSTETIEDEDDEEEVAVQQAKQKDQQQD------- 356
            :     .|..:||             .||..|:      .|.|.....:||.......       
Human  7720 IPELLRGPPDSPSLGVARHLCRDTGGSSSSSSS------SDNELAPFARAKSLPPSPVTHSPLLH 7778

  Fly   357 -----EELANLCGDAELENKELDATKDNL---------------KNFIVR---WETHPNSPYVFD 398
                 ...|:|..:||...:..:|.....               ::.::|   :.....||    
Human  7779 PRGFLRPSASLPEEAEASERSTEAPAPPASPEGAGPPAAQGCVPRHSVIRSLFYHQAGESP---- 7839

  Fly   399 VEGNVIAPLSETSYPHP-RRTHGADSLSSSRVCSPSPCDSISTLTDDERGDIEDLPEE---DESR 459
             |...:||.|..   || ||.|   .|....:....|            |..|.|.|.   :|..
Human  7840 -EHGALAPGSRR---HPARRRH---LLKGGYIAGALP------------GLREPLMEHRVLEEEA 7885

  Fly   460 SAENESPRSVATPINESREKLFPTVAT------------SSPSTPTPQHLFNENFDEFSGSQSTA 512
            :.|.::......|..|:..:| |...|            .|||||.|            .|::..
Human  7886 AREEQATLLAKAPSFETALRL-PASGTHLAPGHSHSLEHDSPSTPRP------------SSEACG 7937

  Fly   513 QQQRSMKSYLHTFDRRNSDTTYLLGRR---SSGERVNLADEIRKLSD----------HLLMLAEI 564
            :.||...:.......|  |..:..|.:   |:|.....|...|...|          |       
Human  7938 EAQRLPSAPSGGAPIR--DMGHPQGSKQLPSTGGHPGTAQPERPSPDSPWGQPAPFCH------- 7993

  Fly   565 NTKLGDANNNGSS---SGAPADP---PAAAAAAAAPVPTS---------TAPASVAPSGSTSSKT 614
             .|.|.|...|.|   :.||..|   |..:...|..||:|         .|||..:|...:....
Human  7994 -PKQGSAPQEGCSPHPAVAPCPPGSFPPGSCKEAPLVPSSPFLGQPQAPPAPAKASPPLDSKMGP 8057

  Fly   615 SEISQEGNRWTSKTTSSSSWNRPTLKGGLFSQASSSSQSQSTYDDGKGKTKISSLSVRLQQ-SIE 678
            .:||..|              ||  |.|..|...|:||:.|        :::|||.|...| ..|
Human  8058 GDISLPG--------------RP--KPGPCSSPGSASQASS--------SQVSSLRVGSSQVGTE 8098

  Fly   679 ETPKL--------SNGNSSSSKSLVQSQRKSTVQTMS 707
            ..|.|        :...|.|:.:|.:.|.::|::..|
Human  8099 PGPSLDAEGWTQEAEDLSDSTPTLQRPQEQATMRKFS 8135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 92/255 (36%)
STKc_MLCK 40..289 CDD:271005 89/249 (36%)
OBSCNNP_001373054.1 Ig strand D 5253..5259 CDD:409353
Ig strand E 5262..5272 CDD:409353
Ig strand G 5282..5293 CDD:409353
Ig_3 5390..5466 CDD:404760
FN3 5480..5565 CDD:238020
IG_like 5587..>5652 CDD:214653
Ig strand B 5597..5603 CDD:409353
Ig strand C 5610..5615 CDD:409353
Ig strand C' 5618..5621 CDD:409353
Ig strand D 5626..5631 CDD:409353
Ig strand E 5634..5639 CDD:409353
I-set 5855..5945 CDD:400151
Ig strand A 5858..5861 CDD:409353
Ig strand A' 5863..5866 CDD:409353
Ig strand B 5870..5879 CDD:409353
Ig strand C 5884..5890 CDD:409353
Ig strand C' 5893..5895 CDD:409353
Ig strand D 5901..5906 CDD:409353
Ig strand E 5909..5917 CDD:409353
Ig strand F 5925..5932 CDD:409353
Ig strand G 5935..5945 CDD:409353
I-set 6083..6173 CDD:400151
Ig strand A 6083..6086 CDD:409353
Ig strand A' 6089..6094 CDD:409353
Ig strand B 6099..6106 CDD:409353
Ig strand C 6113..6119 CDD:409353
Ig strand C' 6120..6123 CDD:409353
Ig strand D 6129..6135 CDD:409353
Ig strand E 6138..6148 CDD:409353
Ig strand F 6152..6160 CDD:409353
Ig strand G 6162..6173 CDD:409353
I-set 6217..6307 CDD:400151
Ig strand A' 6222..6226 CDD:409353
Ig strand B 6234..6243 CDD:409353
Ig strand C 6248..6253 CDD:409353
Ig strand C' 6256..6258 CDD:409353
Ig strand D 6264..6269 CDD:409353
Ig strand E 6272..6277 CDD:409353
Ig strand F 6286..6294 CDD:409353
Ig strand G 6297..6307 CDD:409353
Ig 6328..6423 CDD:416386
Ig strand A 6328..6330 CDD:409353
Ig strand A' 6332..6338 CDD:409353
Ig strand B 6345..6352 CDD:409353
Ig strand C 6358..6363 CDD:409353
Ig strand C' 6365..6368 CDD:409353
Ig strand D 6376..6383 CDD:409353
Ig strand E 6388..6395 CDD:409353
Ig strand F 6402..6410 CDD:409353
Ig strand G 6413..6423 CDD:409353
SH3_Obscurin_like 6559..6621 CDD:212958
RhoGEF 6654..6832 CDD:214619
PH_Obscurin 6839..6963 CDD:270059
IgI_1_Titin-A168_like 6971..7061 CDD:409563
Ig strand B 6988..6992 CDD:409563
Ig strand C 7001..7005 CDD:409563
Ig strand E 7028..7032 CDD:409563
Ig strand F 7041..7046 CDD:409563
Ig strand G 7054..7057 CDD:409563
Ig strand A 7064..7067 CDD:409353
I-set 7065..7154 CDD:400151
Ig strand A' 7070..7074 CDD:409353
Ig strand B 7082..7090 CDD:409353
Ig strand C 7095..7100 CDD:409353
Ig strand C' 7103..7105 CDD:409353
Ig strand D 7111..7116 CDD:409353
Ig strand E 7121..7126 CDD:409353
Ig strand F 7135..7143 CDD:409353
Ig strand G 7146..7156 CDD:409353
I-set 7314..7403 CDD:400151
Ig strand A' 7322..7325 CDD:409353
Ig strand B 7329..7338 CDD:409353
Ig strand C 7343..7349 CDD:409353
Ig strand C' 7352..7354 CDD:409353
Ig strand D 7360..7365 CDD:409353
Ig strand E 7368..7375 CDD:409353
Ig strand F 7383..7390 CDD:409353
Ig strand G 7393..7403 CDD:409353
STKc_obscurin_rpt1 7422..7678 CDD:271009 92/257 (36%)
MISS 7760..8033 CDD:318115 62/318 (19%)
I-set 8420..8505 CDD:400151
Ig strand A 8420..8423 CDD:409353
Ig strand A' 8429..8432 CDD:409353
Ig strand B 8437..8444 CDD:409353
Ig strand C 8450..8455 CDD:409353
Ig strand C' 8458..8460 CDD:409353
Ig strand D 8469..8473 CDD:409353
Ig strand E 8475..8480 CDD:409353
Ig strand F 8489..8497 CDD:409353
Ig strand G 8500..8508 CDD:409353
FN3 8514..8592 CDD:214495
STKc_obscurin_rpt2 8625..8881 CDD:271012
I-set 10..99 CDD:400151
Ig strand A 10..14 CDD:409353
Ig strand A' 17..22 CDD:409353
Ig strand B 26..34 CDD:409353
Ig strand C 40..45 CDD:409353
Ig strand C' 48..50 CDD:409353
Ig strand D 56..59 CDD:409353
Ig strand E 62..68 CDD:409353
Ig strand F 78..86 CDD:409353
I-set 110..201 CDD:400151
Ig strand A' 116..121 CDD:409353
Ig strand B 127..134 CDD:409353
Ig strand C 140..145 CDD:409353
Ig strand C' 147..149 CDD:409353
Ig strand D 158..161 CDD:409353
Ig strand E 167..173 CDD:409353
Ig strand F 180..187 CDD:409353
I-set 248..328 CDD:400151
Ig strand B 254..261 CDD:409353
Ig strand C 268..274 CDD:409353
Ig strand C' 275..278 CDD:409353
Ig strand D 284..290 CDD:409353
Ig strand E 293..303 CDD:409353
Ig strand F 307..315 CDD:409353
Ig strand G 317..328 CDD:409353
Ig 335..418 CDD:416386
Ig strand A' 337..343 CDD:409353
Ig strand B 350..357 CDD:409353
Ig strand C 362..367 CDD:409353
Ig strand D 377..381 CDD:409353
Ig strand E 386..393 CDD:409353
Ig 427..505 CDD:416386
Ig strand A' 431..434 CDD:409353
Ig strand B 437..443 CDD:409353
Ig strand C 450..455 CDD:409353
Ig strand C' 458..461 CDD:409353
Ig strand D 466..471 CDD:409353
Ig strand E 474..479 CDD:409353
Ig strand F 488..494 CDD:409353
Ig strand G 497..505 CDD:409353
FN3 515..602 CDD:238020
Ig 617..>673 CDD:416386
Ig 711..791 CDD:416386
Ig strand A' 715..719 CDD:409353
Ig strand B 723..729 CDD:409353
Ig strand C 736..741 CDD:409353
Ig strand C' 744..747 CDD:409353
Ig strand D 752..757 CDD:409353
Ig strand E 760..765 CDD:409353
Ig strand F 774..780 CDD:409353
Ig strand G 783..791 CDD:409353
Ig 807..883 CDD:416386
Ig strand A' 807..810 CDD:409353
Ig strand B 814..820 CDD:409353
Ig strand C 827..832 CDD:409353
Ig strand C' 835..838 CDD:409353
Ig strand D 844..849 CDD:409353
Ig strand E 852..857 CDD:409353
Ig strand F 866..872 CDD:409353
Ig strand G 875..883 CDD:409353
Ig 894..975 CDD:416386
Ig strand A 894..896 CDD:409353
Ig strand A' 899..903 CDD:409353
Ig strand B 907..913 CDD:409353
Ig strand C 920..925 CDD:409353
Ig strand C' 928..931 CDD:409353
Ig strand D 936..941 CDD:409353
Ig strand E 944..949 CDD:409353
Ig strand F 958..964 CDD:409353
Ig strand G 967..975 CDD:409353
Ig 986..1067 CDD:416386
Ig strand A 986..988 CDD:409353
Ig strand A' 991..995 CDD:409353
Ig strand B 999..1005 CDD:409353
Ig strand C 1012..1017 CDD:409353
Ig strand C' 1020..1023 CDD:409353
Ig strand D 1028..1033 CDD:409353
Ig strand E 1036..1041 CDD:409353
Ig strand F 1050..1056 CDD:409353
Ig strand G 1059..1067 CDD:409353
Ig 1078..1159 CDD:416386
Ig strand A 1078..1080 CDD:409353
Ig strand A' 1083..1087 CDD:409353
Ig strand B 1091..1097 CDD:409353
Ig strand C 1104..1109 CDD:409353
Ig strand C' 1112..1115 CDD:409353
Ig strand D 1120..1125 CDD:409353
Ig strand E 1128..1133 CDD:409353
Ig strand F 1142..1148 CDD:409353
Ig strand G 1151..1159 CDD:409353
Ig 1170..1251 CDD:416386
Ig strand A 1170..1172 CDD:409353
Ig strand A' 1175..1179 CDD:409353
Ig strand B 1183..1189 CDD:409353
Ig strand C 1196..1201 CDD:409353
Ig strand C' 1204..1207 CDD:409353
Ig strand D 1212..1217 CDD:409353
Ig strand E 1220..1225 CDD:409353
Ig strand F 1234..1240 CDD:409353
Ig strand G 1243..1251 CDD:409353
Ig 1262..1343 CDD:416386
Ig strand A 1262..1264 CDD:409353
Ig strand A' 1267..1271 CDD:409353
Ig strand B 1275..1281 CDD:409353
Ig strand C 1288..1293 CDD:409353
Ig strand C' 1296..1299 CDD:409353
Ig strand D 1304..1309 CDD:409353
Ig strand E 1312..1317 CDD:409353
Ig strand F 1326..1332 CDD:409353
Ig strand G 1335..1343 CDD:409353
Ig 1359..1435 CDD:416386
Ig strand A' 1359..1363 CDD:409353
Ig strand B 1367..1373 CDD:409353
Ig strand C 1380..1385 CDD:409353
Ig strand C' 1388..1391 CDD:409353
Ig strand D 1396..1401 CDD:409353
Ig strand E 1404..1409 CDD:409353
Ig strand F 1418..1424 CDD:409353
Ig strand G 1427..1435 CDD:409353
Ig 1446..1527 CDD:416386
Ig strand A 1446..1448 CDD:409353
Ig strand A' 1451..1455 CDD:409353
Ig strand B 1459..1465 CDD:409353
Ig strand C 1472..1477 CDD:409353
Ig strand C' 1480..1483 CDD:409353
Ig strand D 1488..1493 CDD:409353
Ig strand E 1496..1501 CDD:409353
Ig strand F 1510..1516 CDD:409353
Ig strand G 1519..1527 CDD:409353
Ig 1538..1619 CDD:416386
Ig strand A 1538..1540 CDD:409353
Ig strand A' 1543..1547 CDD:409353
Ig strand B 1551..1557 CDD:409353
Ig strand C 1564..1569 CDD:409353
Ig strand C' 1572..1575 CDD:409353
Ig strand D 1580..1585 CDD:409353
Ig strand E 1588..1593 CDD:409353
Ig strand F 1602..1608 CDD:409353
Ig strand G 1611..1619 CDD:409353
Ig 1630..1711 CDD:416386
Ig strand A 1630..1632 CDD:409353
Ig strand A' 1635..1639 CDD:409353
Ig strand B 1643..1649 CDD:409353
Ig strand C 1656..1661 CDD:409353
Ig strand C' 1664..1667 CDD:409353
Ig strand D 1672..1677 CDD:409353
Ig strand E 1680..1685 CDD:409353
Ig strand F 1694..1700 CDD:409353
Ig strand G 1703..1711 CDD:409353
IgI_C2_MyBP-C-like 1722..1803 CDD:409559
Ig strand B 1736..1740 CDD:409559
Ig strand C 1748..1752 CDD:409559
Ig strand E 1773..1777 CDD:409559
Ig strand F 1787..1792 CDD:409559
Ig strand G 1796..1799 CDD:409559
Ig 1814..1895 CDD:416386
Ig strand A 1814..1816 CDD:409353
Ig strand A' 1819..1823 CDD:409353
Ig strand B 1827..1833 CDD:409353
Ig strand C 1840..1845 CDD:409353
Ig strand C' 1848..1851 CDD:409353
Ig strand D 1856..1861 CDD:409353
Ig strand E 1864..1869 CDD:409353
Ig strand F 1878..1884 CDD:409353
Ig strand G 1887..1895 CDD:409353
Ig 1913..1994 CDD:416386
Ig strand A 1913..1915 CDD:409353
Ig strand A' 1918..1922 CDD:409353
Ig strand B 1926..1932 CDD:409353
Ig strand C 1939..1944 CDD:409353
Ig strand C' 1947..1950 CDD:409353
Ig strand D 1955..1960 CDD:409353
Ig strand E 1963..1968 CDD:409353
Ig strand F 1977..1983 CDD:409353
Ig strand G 1986..1994 CDD:409353
Ig 2005..2086 CDD:416386
Ig strand A 2005..2007 CDD:409353
Ig strand A' 2010..2014 CDD:409353
Ig strand B 2018..2024 CDD:409353
Ig strand C 2031..2036 CDD:409353
Ig strand C' 2039..2042 CDD:409353
Ig strand D 2047..2052 CDD:409353
Ig strand E 2055..2060 CDD:409353
Ig strand F 2069..2075 CDD:409353
Ig strand G 2078..2086 CDD:409353
Ig 2091..2168 CDD:416386
Ig strand B 2111..2115 CDD:409353
Ig strand C 2124..2128 CDD:409353
Ig strand E 2149..2153 CDD:409353
Ig strand F 2163..2168 CDD:409353
Ig 2185..2268 CDD:416386
Ig strand B 2200..2206 CDD:409353
Ig strand C 2213..2218 CDD:409353
Ig strand C' 2221..2224 CDD:409353
Ig strand D 2229..2234 CDD:409353
Ig strand E 2237..2242 CDD:409353
Ig strand F 2251..2257 CDD:409353
Ig strand G 2260..2268 CDD:409353
Ig 2275..2358 CDD:416386
Ig strand A' 2279..2283 CDD:409353
Ig strand B 2291..2299 CDD:409353
Ig strand C 2304..2308 CDD:409353
Ig strand C' 2311..2313 CDD:409353
Ig strand D 2319..2324 CDD:409353
Ig strand E 2327..2332 CDD:409353
Ig strand F 2341..2349 CDD:409353
Ig 2365..2444 CDD:416386
Ig strand A' 2367..2373 CDD:409353
Ig strand B 2380..2387 CDD:409353
Ig strand C 2392..2397 CDD:409353
Ig strand C' 2399..2402 CDD:409353
Ig strand D 2407..2411 CDD:409353
Ig strand E 2416..2423 CDD:409353
Ig strand F 2430..2438 CDD:409353
Ig 2453..2536 CDD:416386
Ig 2542..2625 CDD:416386
Ig strand A 2545..2547 CDD:409353
Ig strand A' 2550..2554 CDD:409353
Ig strand B 2557..2563 CDD:409353
Ig strand C 2570..2575 CDD:409353
Ig strand C' 2578..2581 CDD:409353
Ig strand D 2586..2591 CDD:409353
Ig strand E 2594..2599 CDD:409353
Ig strand F 2608..2614 CDD:409353
Ig strand G 2617..2625 CDD:409353
Ig 2631..2714 CDD:416386
Ig strand B 2647..2651 CDD:409353
Ig strand C 2660..2663 CDD:409353
Ig strand E 2684..2688 CDD:409353
Ig strand F 2698..2703 CDD:409353
Ig strand A 2718..2721 CDD:409353
Ig 2722..2803 CDD:416386
Ig strand A' 2724..2728 CDD:409353
Ig strand B 2736..2743 CDD:409353
Ig strand C 2748..2753 CDD:409353
Ig strand C' 2756..2758 CDD:409353
Ig strand D 2764..2769 CDD:409353
Ig strand E 2772..2777 CDD:409353
Ig strand G 2793..2803 CDD:409353
I-set 2899..2982 CDD:400151
Ig strand B 2915..2919 CDD:409353
Ig strand C 2928..2931 CDD:409353
Ig strand E 2952..2956 CDD:409353
Ig strand F 2966..2971 CDD:409353
Ig 2989..3071 CDD:416386
Ig strand A' 2993..2998 CDD:409353
Ig strand B 3003..3010 CDD:409353
Ig strand C 3016..3022 CDD:409353
Ig strand C' 3023..3026 CDD:409353
Ig strand D 3032..3037 CDD:409353
Ig strand E 3040..3050 CDD:409353
Ig strand F 3054..3061 CDD:409353
Ig strand G 3062..3071 CDD:409353
Ig 3077..3160 CDD:416386
Ig strand C 3105..3109 CDD:409353
Ig strand E 3130..3134 CDD:409353
Ig strand F 3144..3149 CDD:409353
Ig 3167..3251 CDD:416386
IG 3263..3340 CDD:214652
Ig 3347..3429 CDD:416386
Ig strand B 3362..3366 CDD:409353
Ig strand C 3374..3378 CDD:409353
Ig strand E 3399..3403 CDD:409353
Ig strand A' 3440..3445 CDD:409353
IG_like 3441..3520 CDD:214653
Ig strand B 3450..3457 CDD:409353
Ig strand C 3464..3470 CDD:409353
Ig strand C' 3471..3474 CDD:409353
Ig strand D 3480..3486 CDD:409353
Ig strand E 3489..3499 CDD:409353
Ig strand G 3509..3520 CDD:409353
Ig 3526..3606 CDD:416386
Ig strand B 3541..3547 CDD:409353
Ig strand C 3554..3559 CDD:409353
Ig strand C' 3562..3565 CDD:409353
Ig strand D 3570..3575 CDD:409353
Ig strand E 3578..3583 CDD:409353
Ig strand F 3592..3598 CDD:409353
Ig strand G 3601..3609 CDD:409353
Ig 3615..3698 CDD:416386
Ig strand A' 3622..3625 CDD:409353
Ig strand B 3629..3638 CDD:409353
Ig strand C 3643..3648 CDD:409353
Ig strand C' 3651..3653 CDD:409353
Ig strand D 3659..3664 CDD:409353
Ig strand E 3667..3674 CDD:409353
Ig strand G 3688..3698 CDD:409353
Ig 3704..3786 CDD:416386
Ig strand B 3719..3725 CDD:409353
Ig strand C 3731..3736 CDD:409353
Ig strand C' 3739..3742 CDD:409353
Ig strand D 3747..3752 CDD:409353
Ig strand E 3755..3760 CDD:409353
Ig strand F 3769..3775 CDD:409353
Ig strand G 3778..3786 CDD:409353
Ig 3792..3874 CDD:416386
Ig strand B 3807..3813 CDD:409353
Ig strand C 3819..3824 CDD:409353
Ig strand C' 3827..3830 CDD:409353
Ig strand D 3835..3840 CDD:409353
Ig strand E 3843..3848 CDD:409353
Ig strand F 3857..3863 CDD:409353
Ig strand G 3866..3874 CDD:409353
Ig 3880..3962 CDD:416386
Ig strand B 3895..3901 CDD:409353
Ig strand C 3907..3912 CDD:409353
Ig strand C' 3915..3918 CDD:409353
Ig strand D 3923..3928 CDD:409353
Ig strand E 3931..3936 CDD:409353
Ig strand F 3945..3951 CDD:409353
Ig strand G 3954..3962 CDD:409353
Ig 3968..4050 CDD:416386
Ig strand A' 3975..3978 CDD:409353
Ig strand B 3984..3992 CDD:409353
Ig strand C' 4002..4004 CDD:409353
Ig strand D 4010..4014 CDD:409353
Ig strand E 4017..4025 CDD:409353
Ig strand G 4040..4050 CDD:409353
Ig 4056..4138 CDD:416386
Ig strand B 4071..4077 CDD:409353
Ig strand C 4083..4088 CDD:409353
Ig strand C' 4091..4094 CDD:409353
Ig strand D 4099..4104 CDD:409353
Ig strand E 4107..4112 CDD:409353
Ig strand F 4121..4127 CDD:409353
Ig strand G 4130..4138 CDD:409353
Ig 4144..4226 CDD:416386
Ig strand B 4159..4165 CDD:409353
Ig strand C 4171..4176 CDD:409353
Ig strand C' 4179..4182 CDD:409353
Ig strand D 4187..4192 CDD:409353
Ig strand E 4195..4200 CDD:409353
Ig strand F 4209..4215 CDD:409353
Ig strand G 4218..4226 CDD:409353
Ig 4232..4314 CDD:416386
Ig strand B 4247..4253 CDD:409353
Ig strand C 4259..4264 CDD:409353
Ig strand C' 4267..4270 CDD:409353
Ig strand D 4275..4280 CDD:409353
Ig strand E 4283..4288 CDD:409353
Ig strand F 4297..4303 CDD:409353
Ig strand G 4306..4314 CDD:409353
Ig 4320..4402 CDD:416386
Ig strand B 4335..4341 CDD:409353
Ig strand C 4347..4352 CDD:409353
Ig strand C' 4355..4358 CDD:409353
Ig strand D 4363..4368 CDD:409353
Ig strand E 4371..4376 CDD:409353
Ig strand F 4385..4391 CDD:409353
Ig strand G 4394..4402 CDD:409353
Ig 4408..4490 CDD:416386
Ig strand B 4423..4429 CDD:409353
Ig strand C 4435..4440 CDD:409353
Ig strand C' 4443..4446 CDD:409353
Ig strand D 4451..4456 CDD:409353
Ig strand E 4459..4464 CDD:409353
Ig strand F 4473..4479 CDD:409353
Ig strand G 4482..4490 CDD:409353
Ig 4496..4578 CDD:416386
Ig strand B 4510..4517 CDD:409353
Ig strand C 4524..4527 CDD:409353
Ig strand D 4541..4544 CDD:409353
Ig strand E 4545..4553 CDD:409353
Ig strand F 4561..4569 CDD:409353
Ig 4584..4666 CDD:416386
Ig strand A' 4591..4595 CDD:409353
Ig strand B 4599..4605 CDD:409353
Ig strand C 4611..4616 CDD:409353
Ig strand C' 4619..4622 CDD:409353
Ig strand D 4627..4632 CDD:409353
Ig strand E 4635..4640 CDD:409353
Ig strand F 4649..4655 CDD:409353
Ig strand G 4658..4666 CDD:409353
IG_like 4679..4754 CDD:214653
Ig strand B 4687..4693 CDD:409353
Ig strand C 4699..4704 CDD:409353
Ig strand C' 4707..4710 CDD:409353
Ig strand D 4715..4720 CDD:409353
Ig strand E 4723..4728 CDD:409353
Ig strand F 4737..4743 CDD:409353
Ig strand G 4746..4754 CDD:409353
Ig 4760..4842 CDD:416386
Ig strand B 4775..4781 CDD:409353
Ig strand C 4787..4792 CDD:409353
Ig strand C' 4795..4798 CDD:409353
Ig strand D 4803..4808 CDD:409353
Ig strand E 4811..4816 CDD:409353
Ig strand F 4825..4831 CDD:409353
Ig strand G 4834..4842 CDD:409353
I-set 4847..4931 CDD:400151
Ig strand A 4851..4853 CDD:409353
Ig strand A' 4855..4859 CDD:409353
Ig strand B 4863..4869 CDD:409353
Ig strand C 4876..4881 CDD:409353
Ig strand C' 4884..4887 CDD:409353
Ig strand D 4892..4897 CDD:409353
Ig strand E 4900..4905 CDD:409353
Ig strand F 4914..4920 CDD:409353
Ig strand G 4923..4931 CDD:409353
Ig 4937..5007 CDD:416386
Ig strand B 4952..4958 CDD:409353
Ig strand C 4965..4970 CDD:409353
Ig strand C' 4973..4976 CDD:409353
Ig strand D 4981..4986 CDD:409353
Ig strand E 4989..4994 CDD:409353
Ig strand F 5003..5009 CDD:409353
Ig strand G 5012..5020 CDD:409353
Ig 5026..5111 CDD:416386
Ig strand A' 5030..5037 CDD:409353
Ig strand B 5041..5047 CDD:409353
Ig strand C 5056..5061 CDD:409353
Ig strand C' 5064..5067 CDD:409353
Ig strand D 5072..5077 CDD:409353
Ig strand E 5080..5085 CDD:409353
Ig strand F 5094..5100 CDD:409353
Ig strand G 5103..5111 CDD:409353
IG 5126..5202 CDD:214652
Ig 5205..5293 CDD:416386
Ig strand A' 5213..5218 CDD:409353
Ig strand B 5223..5230 CDD:409353
Ig strand C 5237..5243 CDD:409353
Ig strand C' 5244..5247 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.