DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and CDPK19

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_197446.1 Gene:CDPK19 / 832065 AraportID:AT5G19450 Length:533 Species:Arabidopsis thaliana


Alignment Length:376 Identity:123/376 - (32%)
Similarity:188/376 - (50%) Gaps:32/376 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE---DKRNVEREVEIMNSL-QHHLIIQL 94
            ||:..|||||:||..|.|.|...|.:.|.|.:...|..   |..:|.||||||..: :|..|:.|
plant    57 YDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPRHPNIVSL 121

  Fly    95 YAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPE 159
            ..|:|....:.:|:||.||||||||:|.... .|||.....::.:.|.:...|.:|::|.|||||
plant   122 KDAFEDDDAVHIVMELCEGGELFDRIVARGH-YTERAAAAVMKTILEVVQICHKHGVMHRDLKPE 185

  Fly   160 NILVLTQK-GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYG--TDMWSVGVIC 221
            |.|...:| .:.:|.|||||:..|.|.:....:.|:|.::||||:.   .:||  .|:||.|||.
plant   186 NFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMAPEVLR---RNYGPEVDIWSAGVIL 247

  Fly   222 YVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKH 286
            |:|:.|:.||..|.:......:..:..||:.:.:..:|....|.:.|:|..|...|::||:.::|
plant   248 YILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSETAKDLVRKMLEPDPKKRLSAAQVLEH 312

  Fly   287 KWLQ---QRPATAATATPITKAASAASKSRLK-----------SVSPVTAPSESSE--DSTETIE 335
            .|:|   :.|..:...|...:....:..::||           ||..|....|:.|  ||.:|.:
plant   313 SWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAEHLSVEEVAGIKEAFEMMDSKKTGK 377

  Fly   336 DEDDE-----EEVAVQQAKQKDQQQDEELANLCGDAELENKELDATKDNLK 381
            ...:|     .::..||....|.|...|.|::.||..|...|..|...:||
plant   378 INLEELKFGLHKLGQQQIPDTDLQILMEAADVDGDGTLNYGEFVAVSVHLK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 95/261 (36%)
STKc_MLCK 40..289 CDD:271005 92/255 (36%)
CDPK19NP_197446.1 STKc_CAMK 57..314 CDD:270687 95/260 (37%)
FRQ1 354..501 CDD:227455 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.