DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and CPK7

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_568281.1 Gene:CPK7 / 831123 AraportID:AT5G12480 Length:535 Species:Arabidopsis thaliana


Alignment Length:386 Identity:125/386 - (32%)
Similarity:190/386 - (49%) Gaps:43/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE---DKRNVEREVEIMNSL-QHH 89
            |....||:..|||||:||..|.|.||..|.:.|.|.:...|..   |..:|.||||||..: :|.
plant    54 DISLQYDLGREVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPKHP 118

  Fly    90 LIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHL 154
            .::.|..::|....:.:|:||.||||||||:|.... .|||.....::.:.|.:...|..|::|.
plant   119 NVVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGH-YTERAAAAVMKTIVEVVQICHKQGVMHR 182

  Fly   155 DLKPENILVLTQK-GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYG--TDMWS 216
            ||||||.|...:| .:.:|.|||||:..|.|.::...:.|:|.::||||:.   .:||  .|:||
plant   183 DLKPENFLFANKKETSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPEVLR---RNYGPEIDVWS 244

  Fly   217 VGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAA 281
            .|||.|:|:.|:.||..|.:......:..:..||:.:.:..:|....|.:.|:|..|...|:|||
plant   245 AGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVRKMLEPDPKKRLTAA 309

  Fly   282 ECMKHKWLQQRPATAATATPITKAASAASKSRLKSVS----------PVTAPSESSEDST---ET 333
            :.::|.|:    ..|..|..::...:.  |:|||..|          .|.|...|.|::.   |.
plant   310 QVLEHTWI----LNAKKAPNVSLGETV--KARLKQFSVMNKLKKRALRVIAEHLSVEEAAGIKEA 368

  Fly   334 IEDED---------DEEEVAVQQAKQK----DQQQDEELANLCGDAELENKELDATKDNLK 381
            .|..|         :|.:..:|:|.|:    |.|...|..::.||..|...|..|...:||
plant   369 FEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDVDGDGTLNYSEFVAVSVHLK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 95/261 (36%)
STKc_MLCK 40..289 CDD:271005 92/255 (36%)
CPK7NP_568281.1 STKc_CAMK 58..316 CDD:270687 95/261 (36%)
FRQ1 356..503 CDD:227455 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.