DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and AT3G19100

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:421 Identity:122/421 - (28%)
Similarity:201/421 - (47%) Gaps:70/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EVGRGKFGTVYKC-----RDKANGLQLAAKFVPIPKREDKRNVE---REVEIMNSLQ-HHLIIQL 94
            |:|||.||  |.|     :.:....::|.|.:|..|.....::|   |||:|:.:|. |..::|.
plant   149 EIGRGHFG--YTCSAKFKKGELKDQEVAVKVIPKSKMTSAISIEDVRREVKILRALSGHQNLVQF 211

  Fly    95 YAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPE 159
            |.|:|....:.:|:||..||||.||::......:|...:..:.|:...:||.|..|:||.|||||
plant   212 YDAFEDNANVYIVMELCGGGELLDRILARGGKYSEDDAKAVLIQILNVVAFCHLQGVVHRDLKPE 276

  Fly   160 NILVLTQKGN-RIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGT--DMWSVGVIC 221
            |.|..:::.| .:|:|||||:....||:||..:.|:..:|||||::   .||.|  |:||:|||.
plant   277 NFLYTSKEENSMLKVIDFGLSDFVRPDERLNDIVGSAYYVAPEVLH---RSYTTEADVWSIGVIA 338

  Fly   222 YVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKH 286
            |:|:.|..||....:......|..|...|::..:..:|.|..||:.:||.||...||||::.:.|
plant   339 YILLCGSRPFWARTESGIFRAVLKADPSFDEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMH 403

  Fly   287 KWL---------------QQRPATAATATPITKAASAASKS-------RLKSVSPVTAPSES--- 326
            .|:               :|..|...:::....|..|.||:       .||:.....||:::   
plant   404 PWIAGYKKIDIPFDILIFKQIKAYLRSSSLRKAALMALSKTLTTDELLYLKAQFAHLAPNKNGLI 468

  Fly   327 ---------SEDSTETIEDEDDEEEVAVQQAKQKDQQQDEELANLCGDAEL---ENKELDATKDN 379
                     :.::||.:::....:.:|:....|......||   .|. |.:   :::.||.    
plant   469 TLDSIRLALATNATEAMKESRIPDFLALLNGLQYKGMDFEE---FCA-ASISVHQHESLDC---- 525

  Fly   380 LKNFIVRWETHPNSPY-VFDVEGNVIAPLSE 409
                   ||......| :|::.||.:..:.|
plant   526 -------WEQSIRHAYELFEMNGNRVIVIEE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 94/261 (36%)
STKc_MLCK 40..289 CDD:271005 93/260 (36%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 94/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.