DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and CPK25

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001318361.1 Gene:CPK25 / 818162 AraportID:AT2G35890 Length:520 Species:Arabidopsis thaliana


Alignment Length:367 Identity:112/367 - (30%)
Similarity:181/367 - (49%) Gaps:36/367 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVP---IPKREDKRNVEREVEIMNSLQHHL--- 90
            ::|::..::|.|:|||.:.|.:|..|.:.|.|.:|   :...||..:|.||:|||.    ||   
plant   130 EYYNLGSKLGHGQFGTTFVCVEKGTGEEYACKSIPKRKLENEEDVEDVRREIEIMK----HLLGQ 190

  Fly    91 --IIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVH 153
              :|.:..|||....:.:|:||..|||||||:|:... .:||......:.:...:...|..|::|
plant   191 PNVISIKGAYEDSVAVHMVMELCRGGELFDRIVERGH-YSERKAAHLAKVILGVVQTCHSLGVMH 254

  Fly   154 LDLKPENIL-VLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYG--TDMW 215
            .||||||.| |...:.:.:|.|||||:....|.:....:.|:|.::||||:|   .:||  .|:|
plant   255 RDLKPENFLFVNDDEDSPLKAIDFGLSMFLKPGENFTDVVGSPYYIAPEVLN---KNYGPEADIW 316

  Fly   216 SVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTA 280
            |.||:.|||:||.:||.||.:.|..:.|...:.|...:.:..:|....|.|.|:|.::...|:||
plant   317 SAGVMIYVLLSGSAPFWGETEEEIFNEVLEGELDLTSDPWPQVSESAKDLIRKMLERNPIQRLTA 381

  Fly   281 AECMKHKWLQQR---PATAATATPITKAASAASKSRLKSVS-PVTAPSESSEDSTETIE-----D 336
            .:.:.|.|::..   |.|....|.:::....::..:||.:: .|.|...|.|:..|..|     |
plant   382 QQVLCHPWIRDEGNAPDTPLDTTVLSRLKKFSATDKLKKMALRVIAERLSEEEIHELRETFKTID 446

  Fly   337 EDDEEEVAVQQAK--------QKDQQQDEELANLCGDAELEN 370
            ......|..::.|        ..|......|..:..|..||:
plant   447 SGKSGRVTYKELKNGLERFNTNLDNSDINSLMQIPTDVHLED 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 92/265 (35%)
STKc_MLCK 40..289 CDD:271005 91/259 (35%)
CPK25NP_001318361.1 STKc_CAMK 132..389 CDD:270687 92/264 (35%)
FRQ1 429..>509 CDD:227455 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.