DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and CPK24

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_180708.1 Gene:CPK24 / 817708 AraportID:AT2G31500 Length:582 Species:Arabidopsis thaliana


Alignment Length:409 Identity:116/409 - (28%)
Similarity:190/409 - (46%) Gaps:38/409 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE---DKRNVEREVEIMNSL-QHHLI 91
            |..||:..|:|||:||..::|.:.:...:.|.|.:...|..   |..:|.||||||..| :|..|
plant    63 HLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEIMRCLPKHPNI 127

  Fly    92 IQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDL 156
            :....|:|.:..:.:|:|:.||||||||:|.... .|||......:.:.|.:...|.:|::|.||
plant   128 VSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGH-YTERAAASVAKTILEVVKVCHEHGVIHRDL 191

  Fly   157 KPENILVLTQKGN---RIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYG--TDMWS 216
            ||||.|.  ..|.   ::|.|||||:..|.|.:|...:.|:|.::||||:.   .:||  .|:||
plant   192 KPENFLF--SNGTETAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMAPEVLR---RNYGPEIDVWS 251

  Fly   217 VGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAA 281
            .|||.|:|:.|:.||..|.:......:.....|||.:.:..:|.|..:.:..:|..:..:|:|..
plant   252 AGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVSHEAKELVKNMLDANPYSRLTVQ 316

  Fly   282 ECMKHKWL---QQRPATAATATPITKAASAASKSRL-KSVSPVTAPSESSEDSTETIE-----DE 337
            |.::|.|:   ::.|.........||.......:|. |.|..:.|.:..:|:....::     |.
plant   317 EVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMNRFKKKVLRIVADNLPNEEIAAIVQMFQTMDT 381

  Fly   338 DDEEEVAVQQAK-----------QKDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWETHP 391
            |....:..::.:           ..|.:...:.|:..|:..|...|......:||.  :..:.|.
plant   382 DKNGHLTFEELRDGLKKIGQVVPDGDVKMLMDAADTDGNGMLSCDEFVTLSIHLKR--MGCDEHL 444

  Fly   392 NSPY-VFDVEGNVIAPLSE 409
            ...: .||..||....|.|
plant   445 QEAFKYFDKNGNGFIELDE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 90/263 (34%)
STKc_MLCK 40..289 CDD:271005 87/257 (34%)
CPK24NP_180708.1 STKc_CAMK 65..323 CDD:270687 90/263 (34%)
FRQ1 363..512 CDD:227455 17/103 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.