DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and camk1b

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_021335371.1 Gene:camk1b / 794026 ZFINID:ZDB-GENE-141014-1 Length:394 Species:Danio rerio


Alignment Length:327 Identity:106/327 - (32%)
Similarity:171/327 - (52%) Gaps:18/327 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDDSE-PEGVLEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPI 67
            ||.|: |.|...|::..:...| :::     ||....:|.|.|..|....:|.....:|.|.:..
Zfish     8 IDRSKMPLGEDGPSWKKKTANI-KDI-----YDFKEVLGTGAFSEVMLAEEKRTRKLVAVKCIAK 66

  Fly    68 PKREDKRN-VEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERV 131
            ...|.|.| :|.|:.:::.::|..|:.|...:|.:..:.:|::|:.|||||||:|:..| .||:.
Zfish    67 KALEGKENSIENEIAVLHKIKHANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGF-YTEKD 130

  Fly   132 CRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTP 195
            ....|:|:.:|:.::|..||||.||||||:|..: .:.::|.|.||||::.......:....|||
Zfish   131 ASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEESKIMISDFGLSKIEGSGSVMSTACGTP 195

  Fly   196 EFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISP 260
            .:|||||:.....|...|.||:|||.|:|:.|..||..|||.:....:..|:|:|:...::.||.
Zfish   196 GYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILRAEYEFDSPYWDDISD 260

  Fly   261 ECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAA-----SKSRLKSVSPV 320
            ...|||..|:.||.:.|.|..:.::|.|:   ....|....|.::.||.     :||:.|.....
Zfish   261 SAKDFIVHLMEKDPNQRYTCEQALQHPWI---AGDTALDKNIHESVSAQIKKNFAKSKWKQAFNA 322

  Fly   321 TA 322
            ||
Zfish   323 TA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 89/256 (35%)
STKc_MLCK 40..289 CDD:271005 87/250 (35%)
camk1bXP_021335371.1 PKc_like 29..291 CDD:328722 91/271 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.