DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Capsl

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_083617.2 Gene:Capsl / 75568 MGIID:1922818 Length:208 Species:Mus musculus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:43/130 - (33%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQK 102
            |..|....|.|::..|..|...|..|                 |.:..|..:             
Mouse    37 GSAGIKGLGRVFRIMDDNNNRTLDFK-----------------EFLKGLNDY------------- 71

  Fly   103 MMCVVLELIEGGELFDR-------VVD-DEFVLTERVCRVFIRQVCEAMAFIH----GNGIVHLD 155
              .||:|..|..|||.|       .:| :||:||.|......|:.....||..    |:|::.::
Mouse    72 --AVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIE 134

  Fly   156  155
            Mouse   135  134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 29/130 (22%)
STKc_MLCK 40..289 CDD:271005 28/128 (22%)
CapslNP_083617.2 EF-hand_7 44..101 CDD:290234 18/88 (20%)
EFh 46..101 CDD:238008 17/86 (20%)
EFh 79..138 CDD:238008 16/56 (29%)
EF-hand_7 80..140 CDD:290234 15/55 (27%)
EF-hand_7 116..185 CDD:290234 4/19 (21%)
EFh 116..182 CDD:298682 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.