powered by:
Protein Alignment sqa and Capsl
DIOPT Version :9
Sequence 1: | NP_001260832.1 |
Gene: | sqa / 36002 |
FlyBaseID: | FBgn0259678 |
Length: | 888 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_083617.2 |
Gene: | Capsl / 75568 |
MGIID: | 1922818 |
Length: | 208 |
Species: | Mus musculus |
Alignment Length: | 130 |
Identity: | 29/130 - (22%) |
Similarity: | 43/130 - (33%) |
Gaps: | 44/130 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQK 102
|..|....|.|::..|..|...|..| |.:..|..:
Mouse 37 GSAGIKGLGRVFRIMDDNNNRTLDFK-----------------EFLKGLNDY------------- 71
Fly 103 MMCVVLELIEGGELFDR-------VVD-DEFVLTERVCRVFIRQVCEAMAFIH----GNGIVHLD 155
.||:|..|..|||.| .:| :||:||.|......|:.....||.. |:|::.::
Mouse 72 --AVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIE 134
Fly 156 155
Mouse 135 134
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.