DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Dclk2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001344389.1 Gene:Dclk2 / 70762 MGIID:1918012 Length:772 Species:Mus musculus


Alignment Length:423 Identity:111/423 - (26%)
Similarity:182/423 - (43%) Gaps:60/423 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PEGV----LEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK 69
            ||||    ...:||:.:           .|.:...:|.|.|..|.:|.|:..|.:.|.|.:...|
Mouse   391 PEGVNGNRCSESFPLLE-----------KYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAK 444

  Fly    70 REDKRN-VEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCR 133
            ...|.: :|.||.|:..::|..||.|....|....:.:|:||::||:|||.:.... ..|||...
Mouse   445 CCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSST-KYTERDGS 508

  Fly   134 VFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNR-IKIIDFGLARKFDPDKRLRVLFGTPE 196
            ..:..:..|:.::|...|||.|:||||:||.. ..|.: :|:.|||||...:..  |..:.|||.
Mouse   509 AMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGP--LYTVCGTPT 571

  Fly   197 FVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDI--ETMSNVTIAKYDFEDECFNGIS 259
            :||||::.........|:|:.|||.|:|:.|..||..||::  :....:...|.:|....::.|:
Mouse   572 YVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNIT 636

  Fly   260 PECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPS 324
            ....:.|:::|..::..|.||.|.:.|.|:..   .|:....:....:...|....:..|     
Mouse   637 DSAKELISQMLQVNVEARCTAGEILSHPWVSD---DASQENNMQAEVTGKLKQHFNNALP----- 693

  Fly   325 ESSEDSTETIEDEDDEEEVAVQQAKQKDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWET 389
              .::||.|        .|:|......|::.....:.||.|:...::|               :|
Mouse   694 --KQNSTTT--------GVSVIMNTALDKEGQIFCSKLCQDSSRPSRE---------------QT 733

  Fly   390 HPNSPYVFDVEGNVIAPLSETSYPHPRRTHGAD 422
            .|..|...:..    .||.....|.|..|.|.|
Mouse   734 SPVPPSAQEAP----PPLESPRPPGPPATSGCD 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 81/259 (31%)
STKc_MLCK 40..289 CDD:271005 80/253 (32%)
Dclk2NP_001344389.1 DCX 67..157 CDD:214711
DCX 191..279 CDD:214711
PKc_like 407..665 CDD:328722 81/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.