DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and RGD1565323

DIOPT Version :10

Sequence 1:NP_724821.2 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001103105.1 Gene:RGD1565323 / 691300 RGDID:1565323 Length:121 Species:Rattus norvegicus


Alignment Length:111 Identity:25/111 - (22%)
Similarity:43/111 - (38%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 SSWNRPTLKGGLFSQASSSSQSQSTYDDGKGKTKISSLSVRLQQSIEETPKLSNGNSSSSKSLVQ 696
            ||:.|.. ||.|.|..........|..| :..|..||| :||..|:.:..:|...:|..|.:.::
  Rat     2 SSYRRQE-KGVLKSHDCVLIYKSETEGD-ESPTPDSSL-IRLTTSMLKVKRLEEISSCHSSNPLE 63

  Fly   697 ------------------SQRKSTVQTMSSSNARSFTNQQVQRTST 724
                              .:..|.:...|..|.|:.|:.:::..:|
  Rat    64 KVAFFQCMEEVEKVKCFLEENSSNLDLQSGDNERTVTSPKLRGPAT 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_724821.2 STKc_MLCK 40..289 CDD:271005
RGD1565323NP_001103105.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.