DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Stk33

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:406 Identity:114/406 - (28%)
Similarity:188/406 - (46%) Gaps:58/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDK--RNVEREVEIMNSLQHHLIIQLYAAYEYQK 102
            :|:|.||.|.:..||..|.:.|.|.|...|....  :.:||||.|:.:::|..||.|...:|..:
  Rat   118 LGQGSFGMVIEATDKETGAKWAIKKVNKEKAGSSAVKLLEREVNILKTVKHQHIIHLEQVFESPQ 182

  Fly   103 MMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-- 165
            .|.:|:||.|.||| ..|:|.....:|...|:.|:.:..|:|::|...|||.|||.|||:|.:  
  Rat   183 KMYLVMELCEDGEL-KEVLDQRGHFSESETRLIIQSLASAIAYLHSKDIVHRDLKLENIMVKSSF 246

  Fly   166 -----QKGNRIKIIDFGLA-RKFD--PDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICY 222
                 :....||:.||||| :|..  .:..::...|||.::||||:|....|...|:||:|||.|
  Rat   247 IDDNNEMNLNIKVSDFGLAVQKHGSRSESMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMY 311

  Fly   223 VLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHK 287
            :|:.|..||:..::.:....:...:..|:|..::.:|......:.:|:..|.:.|:||.|.:.::
  Rat   312 ILLCGEPPFLANSEEKLFELIRKGELQFQDPVWDSVSDSAKSALKQLMKVDPAHRITAKELLDNQ 376

  Fly   288 WLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQQAKQKD 352
            ||.....::|..|.:           |:.:.......||.:|:....|.|...||      |.|.
  Rat   377 WLTGNTLSSARPTNV-----------LEMMKEWKNNPESDDDTKADKETEQHTEE------KLKH 424

  Fly   353 QQQDEELANL--CGDAELENKELDATKDNLKNFIVRWETHPNSPYVFDVEGNVIAPLSETSY--- 412
            .:.:|:..|:  ...|:..|:..|..|               .|   |.:...::|...|||   
  Rat   425 NKIEEKAPNVNHSPSAKSVNQPTDEAK---------------KP---DADSVDMSPSDSTSYKLI 471

  Fly   413 -----PHPRRTHGADS 423
                 ..|.::.|:.|
  Rat   472 SAEIKAEPEKSSGSVS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 85/260 (33%)
STKc_MLCK 40..289 CDD:271005 85/260 (33%)
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.