DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Phkg2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_081164.2 Gene:Phkg2 / 68961 MGIID:1916211 Length:406 Species:Mus musculus


Alignment Length:320 Identity:96/320 - (30%)
Similarity:162/320 - (50%) Gaps:37/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HKHYDVLGEVGRGKFGTVYKCRDKANG-------LQLAAKFVPIPKREDKRN-VEREVEIMNSLQ 87
            ::.||....:|||....|.:|..:|.|       ::::|:.:.:.:.|:.|: ..||:.|:..:.
Mouse    21 YQKYDPKDIIGRGVSSVVRRCVHRATGDEFAVKIMEVSAERLSLEQLEEVRDATRREMHILRQVA 85

  Fly    88 -HHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGI 151
             |..||.|..:||....|.:|.:|:..||||| .:.::..|:|:..|..:|.:.||::|:|.|.|
Mouse    86 GHPHIITLIDSYESSSFMFLVFDLMRKGELFD-YLTEKVALSEKETRSIMRSLLEAVSFLHANNI 149

  Fly   152 VHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCI------SY 210
            ||.||||||||:  ....:|::.|||.:...:..::||.|.|||.::|||::.  |.      .|
Mouse   150 VHRDLKPENILL--DDNMQIRLSDFGFSCHLEAGEKLRELCGTPGYLAPEILK--CSMDETHPGY 210

  Fly   211 G--TDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKD 273
            |  .|:|:.|||.:.|::|..||.....|..:..:...:|.|....::..|....|.|:|||..|
Mouse   211 GKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFTSPEWDDRSNTVKDLISKLLQVD 275

  Fly   274 LSTRMTAAECMKHKWLQQRPAT------------AATATPITKAASAASKSRLKSVSPVT 321
            ...|:||.:.::|.:.::...:            .|..|.:.....|.|..||:   |:|
Mouse   276 PEARLTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTILAAGRVALSSHRLR---PLT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 88/271 (32%)
STKc_MLCK 40..289 CDD:271005 86/265 (32%)
Phkg2NP_081164.2 PKc_like 13..291 CDD:419665 88/274 (32%)
Calmodulin-binding (domain-N). /evidence=ECO:0000250 306..330 6/26 (23%)
Calmodulin-binding (domain-C). /evidence=ECO:0000250 346..370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.