DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and STK33

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001275990.1 Gene:STK33 / 65975 HGNCID:14568 Length:514 Species:Homo sapiens


Alignment Length:455 Identity:128/455 - (28%)
Similarity:209/455 - (45%) Gaps:76/455 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDK--RNVEREVEIMNSLQHHLIIQLYAAYEYQK 102
            :|:|.||.|.:..||....:.|.|.|...|....  :.:||||.|:.|::|..||.|...:|..|
Human   122 LGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPK 186

  Fly   103 MMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILV---L 164
            .|.:|:||.|.||| ..::|.:...:|...|..|:.:..|:|::|.|.|||.|||.|||:|   |
Human   187 KMYLVMELCEDGEL-KEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSL 250

  Fly   165 TQKGN----RIKIIDFGLA--RKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYV 223
            ....|    .||:.|||||  ::...:..|:...|||.::||||::....|...|:||:||:.|:
Human   251 IDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYM 315

  Fly   224 LISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAK-DLSTRMTAAECMKHK 287
            |:.|..||:..::.:....:...:..||:..:|.|| :|...:.|.|.| |.:.|:||.|.:.::
Human   316 LLRGEPPFLASSEEKLFELIRKGELHFENAVWNSIS-DCAKSVLKQLMKVDPAHRITAKELLDNQ 379

  Fly   288 WLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSE--DSTETIEDEDDEEEVAVQQAKQ 350
            ||                    :.::|.||.|........|  ::.|::|:...||         
Human   380 WL--------------------TGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEE--------- 415

  Fly   351 KDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWETHPNSPYVFDVEGNVIAPLSETSYPHP 415
                                |...:|::.||:: ..|...|::.|..|.|....:...|..:|  
Human   416 --------------------KNKPSTEEKLKSY-QPWGNVPDANYTSDEEEEKQSTAYEKQFP-- 457

  Fly   416 RRTHGADSLSSSRVCSPSPCDSISTLTDDERGDIEDLPEEDESRSAENESPRSVATPINESREKL 480
                 |.|..:..:|| |...|...|..:.:|::|..|......:|.....:|.|  ::.:::||
Human   458 -----ATSKDNFDMCS-SSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGA--LSRTKKKL 514

  Fly   481  480
            Human   515  514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 91/260 (35%)
STKc_MLCK 40..289 CDD:271005 91/260 (35%)
STK33NP_001275990.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..91
STKc_STK33 114..381 CDD:270999 91/260 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..468 17/102 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..514 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.