DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and stk33

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001038554.2 Gene:stk33 / 565828 ZFINID:ZDB-GENE-040724-242 Length:500 Species:Danio rerio


Alignment Length:500 Identity:140/500 - (28%)
Similarity:215/500 - (43%) Gaps:103/500 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDK------RNVEREVEIMNSLQHHL 90
            |.|....::|:|.||.|  |  :|..::...|:......::|      :::||||.||..::|..
Zfish    46 KIYSFGRKLGQGSFGVV--C--EATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEH 106

  Fly    91 IIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLD 155
            ||.|...:|..|.|.:|.||.|||:|.|.:..::. .||...|..|:.:.||:.::|...|||.|
Zfish   107 IIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKH-FTEEETRHIIKSLSEAIVYLHKKDIVHRD 170

  Fly   156 LKPENILVLT-QKGN-----RIKIIDFGLARK---FDPDKRLRVLFGTPEFVAPEVVNFDCISYG 211
            ||.|||||.: .:||     .||:.||||:.:   ...:..|:...|||.::||||||....|..
Zfish   171 LKLENILVKSCHQGNDNDMVNIKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQ 235

  Fly   212 TDMWSVGVICYVLISGLSPFMGENDIETMSNVTI-AKYDFEDECFNGISPECLDFIAKLLAKDLS 275
            .|:||:|||.|:|:.|..|| |.:..|.:|.:.: .:..|....:|.||....:.|..||..|.:
Zfish   236 CDLWSIGVIMYMLLCGEPPF-GSSSKERLSEMIMKGELTFSGPVWNTISDAAKNVIRCLLKVDPA 299

  Fly   276 TRMTAAECMKHKWLQQRPATAATAT------------PITKAASAASKSRLKSVSPVTAPSESSE 328
            .|:||.|.:.:.|:....:||.|.|            |..:.....|:. |.|:|..::..:.|.
Zfish   300 HRITANELLDNPWISGDTSTAVTRTNVLEMMRQFRNAPEDEVIGETSEG-LHSLSLSSSQDKGSG 363

  Fly   329 DSTETIEDEDDEEEVAVQQAKQKDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWETHPNS 393
            ..|        .:|::|..|..:|          ..|:...:|.....|..||.           
Zfish   364 PRT--------SQELSVTPATSED----------VTDSSNGSKPSTPNKKPLKK----------- 399

  Fly   394 PYVFDVEGNVIAPLSETSYPHPRRTHGADSLSSSRVCSP------------SPCDSISTLTDDER 446
                        .||.:|....::|     :||::.||.            .|....||.:..:.
Zfish   400 ------------KLSASSSNGVKKT-----VSSTKACSTLNSSTTQSHTGNKPSAQPSTKSYSKA 447

  Fly   447 GDI--EDL-PEEDESRSA-------ENESPRSVATPINESREKLF 481
            ..|  ..| |...|:.:|       |:.|||...|.|:.|....|
Zfish   448 SSILGSSLKPSSSEAPAAASNSSRRESSSPRPTTTSIHRSTNPAF 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 94/270 (35%)
STKc_MLCK 40..289 CDD:271005 93/264 (35%)
stk33NP_001038554.2 PKc_like 46..313 CDD:304357 95/272 (35%)
S_TKc 48..313 CDD:214567 94/270 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.