DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and mylk3

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001099057.1 Gene:mylk3 / 561635 ZFINID:ZDB-GENE-030131-3497 Length:715 Species:Danio rerio


Alignment Length:291 Identity:142/291 - (48%)
Similarity:205/291 - (70%) Gaps:6/291 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIYIDDSEPEGVLEPAFPMRDVTINRNVDAHKHYDV--LGEVGRGKFGTVYKCRDKANGLQLAAK 63
            ::.||||.|   |...|..|.|:. :.|..:.:|.|  :..:|.|:||.|:||.:.::||.||||
Zfish   373 LLIIDDSPP---LPAPFDHRIVSA-KQVPINSYYAVNPVEVLGGGRFGQVHKCAELSSGLTLAAK 433

  Fly    64 FVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLT 128
            .:.:...:::..|:.|:.:||.|.|..:||||.|:|.:..:.:::|.:||||||:|::|:.:.||
Zfish   434 IIKVRGMKERDEVKNEIGVMNQLNHVNLIQLYDAFESRTNLTLIMEYVEGGELFERIIDESYQLT 498

  Fly   129 ERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFG 193
            |....||.||:||.:.::|...|:||||||||||.:...||:|||||||||||:.|.::|:|.||
Zfish   499 ELDAIVFTRQICEGVQYLHQQYILHLDLKPENILCVNSTGNQIKIIDFGLARKYRPREKLKVNFG 563

  Fly   194 TPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGI 258
            ||||:||||||:|.:|:.|||||||||.|:|:||||||||:||.|||:|:..||::|:.|.|..:
Zfish   564 TPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPFMGDNDAETMNNILHAKWEFDTEAFENV 628

  Fly   259 SPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289
            |.|..|||:.||.....:|::|:.||||.||
Zfish   629 SEEAKDFISSLLVSAKCSRLSASGCMKHSWL 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 130/256 (51%)
STKc_MLCK 40..289 CDD:271005 128/248 (52%)
mylk3NP_001099057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..114
STKc_MLCK3 399..659 CDD:271094 130/259 (50%)
S_TKc 407..659 CDD:214567 128/251 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 1 1.000 - - X2697
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.