DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and si:dkey-240h12.4

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_021323963.1 Gene:si:dkey-240h12.4 / 555536 ZFINID:ZDB-GENE-070705-406 Length:361 Species:Danio rerio


Alignment Length:266 Identity:111/266 - (41%)
Similarity:169/266 - (63%) Gaps:11/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE------DKRNVEREVEIMNSLQHHLII 92
            |::...:|.|.||.|.:.|::|.|:..|.||:.:.|..      ::::||:||||:.||||..|:
Zfish    13 YEIGNVLGSGHFGQVREVRERATGVLWAGKFLKLKKGAGSRLGLERKSVEKEVEILQSLQHQNIM 77

  Fly    93 QLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLK 157
            .:...:|.:..:.:::|||:||||||.:.:.| .|||.....|::|:.|.:.::|...:.|.|||
Zfish    78 AIRDVFESRAEIVLIVELIKGGELFDFIAEKE-NLTETEAIEFMKQILEGVNYMHQKNVAHFDLK 141

  Fly   158 PENILVLTQKGN---RIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGV 219
            ||||: |:.|.:   .|||||||:|..|...:..:.|.|||:::|||::|::.:....||||:||
Zfish   142 PENIM-LSDKHDPHPDIKIIDFGMAHHFIQGEEYKSLGGTPQYIAPEIINYEPLGTAADMWSIGV 205

  Fly   220 ICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECM 284
            |.|:|:||||||.||.|.||:.|:....|:||...|:..:....|||.|||.||.|.||||.||:
Zfish   206 ITYILLSGLSPFQGETDEETLRNIVSMNYEFEPHFFSQTTNMAKDFIQKLLVKDQSERMTAEECL 270

  Fly   285 KHKWLQ 290
            .|.|::
Zfish   271 IHPWIK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 110/263 (42%)
STKc_MLCK 40..289 CDD:271005 109/257 (42%)
si:dkey-240h12.4XP_021323963.1 PKc_like 7..275 CDD:328722 110/263 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.