DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and capslb

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001017776.2 Gene:capslb / 550473 ZFINID:ZDB-GENE-050417-298 Length:209 Species:Danio rerio


Alignment Length:65 Identity:19/65 - (29%)
Similarity:30/65 - (46%) Gaps:13/65 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VVLELIEGGELFDRV-------VD-DEFVLTERVCRVFIRQVCEAMAFIH----GNGIVHL-DLK 157
            |::|..|...||.:.       :| |||::|.|......|:.....||..    |:|::.: |||
Zfish    73 VLMEKEEAINLFQQFDRDGSGQIDFDEFLITLRPPMSNARKEVVLQAFKKLDKTGDGVITVEDLK 137

  Fly   158  157
            Zfish   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 19/65 (29%)
STKc_MLCK 40..289 CDD:271005 19/65 (29%)
capslbNP_001017776.2 EF-hand_7 44..101 CDD:290234 8/27 (30%)
EFh 46..101 CDD:238008 8/27 (30%)
EFh 79..136 CDD:298682 14/56 (25%)
EF-hand_7 82..140 CDD:290234 16/56 (29%)
EF-hand_7 118..185 CDD:290234 7/20 (35%)
EFh 119..182 CDD:298682 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.