DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and PHKG1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_016867813.1 Gene:PHKG1 / 5260 HGNCID:8930 Length:432 Species:Homo sapiens


Alignment Length:363 Identity:100/363 - (27%)
Similarity:151/363 - (41%) Gaps:73/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAK---------FVPIPKREDKRNVEREVEIMN 84
            |.:::|:....:|||....|.:|..|....:.|.|         |.|...||.:....:||:|:.
Human    15 DFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREATLKEVDILR 79

  Fly    85 SLQ-HHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHG 148
            .:. |..||||...||......:|.:|::.||||| .:.::..|:|:..|..:|.:.|.:..:|.
Human    80 KVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFD-YLTEKVTLSEKETRKIMRALLEVICTLHK 143

  Fly   149 NGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRV----------------------- 190
            ..|||.||||||||:  .....||:.|||.:.:.:|.:||||                       
Human   144 LNIVHRDLKPENILL--DDNMNIKLTDFGFSCQLEPGERLRVETGFHHVGQAGLELLTLRSARLG 206

  Fly   191 ----------------------LFGTPEFVAPEVV----NFDCISYG--TDMWSVGVICYVLISG 227
                                  :.|||.::|||::    |.|...||  .||||.|||.|.|::|
Human   207 LPKCCDYRREPPCPAGLGISSEVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAG 271

  Fly   228 LSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWLQQ- 291
            ..||.....:..:..:....|.|....::..|....|.:::.|......|.||.|.:.|.:.|| 
Human   272 SPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQY 336

  Fly   292 --------RPATAATATPITKAASAASKSRLKSVSPVT 321
                    .|........:|..||.....:.:.|.|||
Human   337 LVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 89/315 (28%)
STKc_MLCK 40..289 CDD:271005 88/309 (28%)
PHKG1XP_016867813.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.