DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Camk1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_598687.1 Gene:Camk1 / 52163 MGIID:1098535 Length:374 Species:Mus musculus


Alignment Length:263 Identity:96/263 - (36%)
Similarity:144/263 - (54%) Gaps:3/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKR-NVEREVEIMNSLQHHLII 92
            |....||....:|.|.|..|....||.....:|.|.:.....|.|. ::|.|:.:::.::|..|:
Mouse    15 DIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNIV 79

  Fly    93 QLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLK 157
            .|...||....:.::::|:.|||||||:|:..| .|||.....|.||.:|:.::|..||||.|||
Mouse    80 ALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHDLGIVHRDLK 143

  Fly   158 PENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVIC 221
            |||:|..: .:.::|.|.||||::..||...|....|||.:|||||:.....|...|.||:|||.
Mouse   144 PENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIA 208

  Fly   222 YVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKH 286
            |:|:.|..||..|||.:....:..|:|:|:...::.||....|||..|:.||...|.|..:.::|
Mouse   209 YILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQH 273

  Fly   287 KWL 289
            .|:
Mouse   274 PWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 94/256 (37%)
STKc_MLCK 40..289 CDD:271005 92/250 (37%)
Camk1NP_598687.1 STKc_CaMKI_alpha 16..278 CDD:271069 95/262 (36%)
Autoinhibitory domain. /evidence=ECO:0000250 276..316 0/1 (0%)
Calmodulin-binding. /evidence=ECO:0000250 296..317
Nuclear export signal. /evidence=ECO:0000250 315..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.