DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and phkg1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001005722.1 Gene:phkg1 / 448255 XenbaseID:XB-GENE-987485 Length:388 Species:Xenopus tropicalis


Alignment Length:317 Identity:92/317 - (29%)
Similarity:149/317 - (47%) Gaps:31/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK--------REDKRNVEREVEIMNSLQ 87
            ::.|:....:|||....|.:|..|.:....|.|.:.|..        .|.:.:..:|::|:..:.
 Frog    17 YEKYEPKEILGRGVSSVVRRCIFKPSREDFAVKIIDITGDHLSSEQIAELRDSTVKEIDILKKVS 81

  Fly    88 -HHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGI 151
             ...:|||..:||......:|.:|:..||||| .:.::..|:|:..|..:|.:.|.::.:|...|
 Frog    82 GFPNVIQLKDSYESHTFFFLVFDLMRRGELFD-YLTEKVTLSEKETRKIMRSLLEVVSKLHAYNI 145

  Fly   152 VHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDC------ISY 210
            ||.||||||||:  .....||:.|||.:.:....::|:.:.|||.::|||:::  |      ..|
 Frog   146 VHRDLKPENILL--DDDMNIKLTDFGFSCQIQEGEKLKEICGTPGYLAPEILH--CSMDENHSGY 206

  Fly   211 G--TDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKD 273
            |  .||||.|||.|.|::|..||.....:..:..:...:|.|....::..|....|.||:||..:
 Frog   207 GKQVDMWSCGVIMYTLLAGSPPFWHRKQMLMLRMIMSGEYHFGSPEWDDRSDTVKDLIARLLVVN 271

  Fly   274 LSTRMTAAECMKHKWLQQ---------RPATAATATPITKAASAASKSRLKSVSPVT 321
            ...|:||.|.:.|.:.||         .|........:|..||.......:.|.|||
 Frog   272 PERRLTADEALIHPFFQQYDVEEVRYFSPFRKFKVVCLTVLASVRIYHYYRKVKPVT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 82/271 (30%)
STKc_MLCK 40..289 CDD:271005 81/265 (31%)
phkg1NP_001005722.1 PKc_like 16..290 CDD:419665 83/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.