DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and nek2

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_012823629.1 Gene:nek2 / 407849 XenbaseID:XB-GENE-962774 Length:425 Species:Xenopus tropicalis


Alignment Length:394 Identity:140/394 - (35%)
Similarity:209/394 - (53%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EPAFPMRDVTINRNVDAHKH------YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE- 71
            |....:.|...|.|:.:.||      |::|.::|.|.||.|.||::|:.|...|.||:...|.: 
 Frog    31 EDIIHLEDEVFNPNMTSFKHENVEDLYELLEKLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKG 95

  Fly    72 -----DKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERV 131
                 |:..|||||.|:..|:|..|::|:..:..:..|.::||||.||||||.:.:.| .|:|..
 Frog    96 SRLGLDRDQVEREVFILQQLEHPNIMRLHDVFASKAEMVLILELIRGGELFDFIAEKE-ALSEED 159

  Fly   132 CRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKG---NRIKIIDFGLARKFDPDKRLRVLFG 193
            ...|:.|:.:.:|::|...|.|.|||||||::| ||.   .:|||||||||:|.:.....:.|.|
 Frog   160 AIEFLEQILKGVAYMHTRSIAHFDLKPENIMLL-QKDVPHPKIKIIDFGLAQKIEDGTVFKSLCG 223

  Fly   194 TPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGI 258
            ||:::||||:|::.:...|||||:|||.|:|:||||||.||.|.||::||....|:|:|..|...
 Frog   224 TPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGETDQETLTNVVAGSYEFDDRIFKQT 288

  Fly   259 SPECLDFIAKLLAKDLSTRMTAAECMKHKW---LQQRPATAATATPIT----KAASAASKSR--- 313
            |....|||.:||.||...||||.||:.|.|   |.::.|...:.:.|.    |..:|..|.:   
 Frog   289 SELAKDFIRQLLLKDPRDRMTAVECLIHPWIKPLNRKQAVNRSRSSINMKNFKKFNARRKWKLSY 353

  Fly   314 -------------------------------LKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQQ 347
                                           |:..||:|..|..:....|:  |::||:...|..
 Frog   354 NMVSACNRLCRMKLLCNPMKDEEELFYSGDLLRPTSPLTERSNKTRRQCES--DQEDEKTKPVTL 416

  Fly   348 AKQK 351
            .:::
 Frog   417 LRRR 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 118/266 (44%)
STKc_MLCK 40..289 CDD:271005 116/260 (45%)
nek2XP_012823629.1 STKc_DAPK 51..319 CDD:271007 117/269 (43%)
S_TKc 57..319 CDD:214567 117/263 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.