DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and stk17b

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_956829.1 Gene:stk17b / 393507 ZFINID:ZDB-GENE-040426-1499 Length:354 Species:Danio rerio


Alignment Length:357 Identity:127/357 - (35%)
Similarity:200/357 - (56%) Gaps:42/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VDAHKH-------YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPK--REDKRNVEREVEIM 83
            :.:|.|       :|:..|:|||||..|.:|.:|..|...||||:...:  |:.:.:|..|:.::
Zfish    19 IHSHIHTDPLDTLFDIGKELGRGKFAVVKRCVEKTTGKVFAAKFIKKRRRGRDCRADVIHEIAVL 83

  Fly    84 NSLQHH-LIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIH 147
            .:.::: .::.|.|.||....:.::||...|||:|:..|.||.:...::.|: |||:.|.:..:|
Zfish    84 EAAKNNPRVVNLNAVYETDYDLVLMLEFAAGGEIFNHCVSDELLPEGQITRL-IRQMLEGIHLLH 147

  Fly   148 GNGIVHLDLKPENILV--LTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISY 210
            .:.:|||||||:|||:  |:..|: |||:||||||:......||.:.||||:||||::|::.|:.
Zfish   148 QSSVVHLDLKPQNILLTSLSPLGD-IKIVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITT 211

  Fly   211 GTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLS 275
            .||:||||||.|:|::|.|||.|::..||..||:....::..|.|:.:|...:|||.|||.|...
Zfish   212 ATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLLVKAPE 276

  Fly   276 TRMTAAECMKHK--WLQQRPATAATATPIT-KAASAASKSRLKSVSPVTAPSESSEDSTETIEDE 337
            .|.:||:||.|.  |||...:.....||.| :..|...|        .:||.          ||.
Zfish   277 DRPSAADCMTHPWLWLQYPGSDPVPMTPRTPRERSFGGK--------WSAPP----------EDP 323

  Fly   338 DDEEEVAVQQAKQKDQQQDEELA------NLC 363
            :|:|.: :.....|..:.||:::      |||
Zfish   324 EDKENI-LDSPHAKRFRFDEDMSATGDGDNLC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 105/261 (40%)
STKc_MLCK 40..289 CDD:271005 103/255 (40%)
stk17bNP_956829.1 STKc_DRAK2 24..290 CDD:271100 106/267 (40%)
S_TKc 32..290 CDD:214567 105/259 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.