DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and triob

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_009290354.2 Gene:triob / 368847 ZFINID:ZDB-GENE-030616-399 Length:3023 Species:Danio rerio


Alignment Length:287 Identity:98/287 - (34%)
Similarity:153/287 - (53%) Gaps:17/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFV--PIPKREDKRNVEREVEIMNSLQHHLIIQLYA 96
            |..:.|:|||:|.....|..:.:...:|||.|  .:.:||   .|.:|:.::..|||..::.|..
Zfish  2721 YTEVMELGRGRFAVTKWCEQRGSRRSVAAKLVNKKLMRRE---QVVQELGVLQCLQHPHLVGLLD 2782

  Fly    97 AYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENI 161
            .||......::||:.:.|.:.|.:| ....|||....:::|.|.||:.::|...|.||||||||:
Zfish  2783 TYETPASYVLILEIADQGRILDYIV-SWGNLTEEKVSLYLRDVLEALHYLHACRIAHLDLKPENV 2846

  Fly   162 LV-LTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLI 225
            |: .|.....:|:.|||.|........:..|.|:|||.|||:|..:..:..:|:||:||:.||::
Zfish  2847 LIEQTSAKPLVKLADFGDAAHLSNTPYIHPLLGSPEFSAPELVLGEPAALASDLWSLGVLAYVML 2911

  Fly   226 SGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHK-WL 289
            ||.|||:.|:..||..|:....:.|.::.|:|:|....|||..||..:...|.:|..|:..: ||
Zfish  2912 SGASPFLDESVEETCLNICRIDFSFPEDYFHGVSQAARDFICMLLQGEPCRRPSAQVCLHEEFWL 2976

  Fly   290 QQRPATAATATPITKAASAASKSRLKS 316
            |  |.|       |.:|:....|||.|
Zfish  2977 Q--PDT-------TSSAARLDTSRLIS 2994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 87/258 (34%)
STKc_MLCK 40..289 CDD:271005 85/252 (34%)
triobXP_009290354.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.