DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Speg

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_038939815.1 Gene:Speg / 363256 RGDID:2124 Length:3269 Species:Rattus norvegicus


Alignment Length:1056 Identity:247/1056 - (23%)
Similarity:393/1056 - (37%) Gaps:333/1056 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EPEGVLEPAFPMRDVTINRNVDAHK------HYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVP 66
            |.|||.|.             :.|:      :||:..|:|||.|..:.:..::::||:.||||:|
  Rat  1597 EVEGVGED-------------EEHRGRRLSDYYDIHQEIGRGAFSYLRRVVERSSGLEFAAKFIP 1648

  Fly    67 IPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERV 131
             .:.:.|.:..||..::..|||..::..:.|:|.::.:.:|.||.. .||.:|:.....| .|..
  Rat  1649 -SQAKPKASARREARLLARLQHDCVLYFHEAFERRRGLVIVTELCT-EELLERMARKPTV-CESE 1710

  Fly   132 CRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKG--NRIKIIDFGLARKFDPDKRLRVLFGT 194
            .|.::|||.|.:.::|.:.::|||:||||:||....|  .:::|.|||.|::..|.:.....|||
  Rat  1711 TRTYMRQVLEGIGYLHQSHVLHLDVKPENLLVWDGAGGEEQVRICDFGNAQELTPGEPQYCQFGT 1775

  Fly   195 PEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGIS 259
            |||||||:||...:|..||:|.|||:.::.::|:|||:||||..|:.|:......||:..|..:|
  Rat  1776 PEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLS 1840

  Fly   260 PECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVS------ 318
            .|...|:.|:|.:| ..|.||.|.::|.|.:.....|..:|...|...:..:.:...:|      
  Rat  1841 REARGFLIKVLVQD-RLRPTAEETLEHPWFKTEAKGAEVSTDHLKLFLSRRRWQRSQISYKCHLV 1904

  Fly   319 --PV----TAPSE-----------------SSEDSTETIEDEDDEEEVAVQQAKQKDQQQDE-EL 359
              |:    .||.|                 ||.||    |:|:.||..:|.:..|.:..... .|
  Rat  1905 LRPIPELLRAPPERVWVAMPRRQPPSGGLSSSSDS----EEEELEELPSVPRPLQPEFSGSRVSL 1965

  Fly   360 ANL-CGDAELENKELDATKDNLKNFIVRWETHPNSPYVFDVEGNVIAPLSET---------SYPH 414
            .:: ..|..|...|..|...      :.|:....:|.. |.|    ||..|.         ..|.
  Rat  1966 TDIPTEDEALGTPEAGAATP------MDWQEQGRAPSK-DQE----APSPEALPSPGQESPDGPS 2019

  Fly   415 PRR------------------------THGADSLSSSRVCSPSP--------------------- 434
            |||                        .|.|.|:...:..||||                     
  Rat  2020 PRRPELRRGSSAESALPRVGSREPGRSLHKAASVELPQRRSPSPGATRLTRGGLGEGEYAQRLQA 2084

  Fly   435 ----------------------CDSISTLTDDER------------------------------G 447
                                  .:|:.....|.|                              |
  Rat  2085 LRQRLLRGGPEDGKVSGLRGPLLESLGGRARDPRMARAASSEAAPHHQPPPESRGLQKSSSFSQG 2149

  Fly   448 DIE------------DLP---------EEDESRSAENES-PRSVATP------INESREKLFPTV 484
            :.|            ::|         :|..|.||.:|: |.|.|.|      |.:|.|   |:.
  Rat  2150 EAEPRGRHRRAGAPLEIPVARLGARRLQESPSLSALSETQPPSPALPSAPKPSITKSPE---PSA 2211

  Fly   485 ATS--SPSTPTPQHL---FNENFDEFSGSQSTAQQQRSMKSYLHTFDRRNSDTTYLLGRRSSGER 544
            |||  ||..|.||.:   ..|...|...:...||...:::.      ...|.|.|          
  Rat  2212 ATSRDSPQPPAPQPVPEKIPEPKPEPVRAAKPAQPPLALQM------PAQSLTPY---------- 2260

  Fly   545 VNLADEIRKLSDHLLMLAEINTKLGDANNNGSSSGAPADP-PAAA--AAAAAP--------VPTS 598
                             |:|...|..::...|....|::| |.||  |..|:|        ||::
  Rat  2261 -----------------AQIMQSLQLSSPTLSPQVPPSEPKPHAAVFARVASPPPGASEKRVPSA 2308

  Fly   599 TAPASVA-----------PSGSTSSKTSEISQE-----------------GNRWTSKTTS----- 630
            ..|..:|           |..|.|.....:..|                 |.|..|::.|     
  Rat  2309 RIPPVLAEKVRVPTVPPRPGSSLSGSIENLESEAVFEAKFKRSRESPLSRGLRLLSRSRSEERGP 2373

  Fly   631 -----SSSWNRPTLKGGLFSQASSSSQSQSTYD---DGKGKTKISSLSVRLQQSIEETP------ 681
                 .....||:..|..........:|:|..|   .|: ...:..||:.|.|.:..||      
  Rat  2374 FRGAEDDGIYRPSPAGTPLELVRRPERSRSVQDLRVAGE-PGLVRRLSLSLSQKLRRTPPGQRHP 2437

  Fly   682 ---------KLSNGNSSSSKSLVQSQRK---STVQTMSSSNARSFTNQQVQRTSTTSSKVISSST 734
                     :.|.|.||:..|.|.:.|:   ||::.:||...||.:::.....|..|:.:.....
  Rat  2438 AWESRSGDGESSEGGSSARGSPVLAVRRRLSSTLERLSSRLQRSGSSEDSGGASGRSTPLFGRLR 2502

  Fly   735 RSSNTSSS--------NYIASNASNSISTSASNPS--STGASNPITTSASNESASSRRAKFRINQ 789
            |:::...|        |.:||      .|.|:.||  |.|:....|:.:|....|..|.::.:::
  Rat  2503 RATSEGESLRRLGVPHNQLAS------QTGATTPSAESLGSEASGTSGSSAPGESRSRHRWGLSR 2561

  Fly   790 MSRDVPVGLPDTHQTV 805
            :.:|..:..|:...:|
  Rat  2562 LRKDKGLSQPNLSASV 2577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 95/256 (37%)
STKc_MLCK 40..289 CDD:271005 92/250 (37%)
SpegXP_038939815.1 I-set 45..127 CDD:400151
Ig strand A 45..47 CDD:409353
Ig strand A' 49..55 CDD:409353
Ig strand B 62..69 CDD:409353
Ig strand C 75..80 CDD:409353
Ig strand C' 82..85 CDD:409353
Ig strand F 106..114 CDD:409353
Ig strand G 117..127 CDD:409353
PHA03247 <324..681 CDD:223021
Ig strand A 736..739 CDD:409353
I-set 737..826 CDD:400151
Ig strand A' 742..746 CDD:409353
Ig strand B 754..762 CDD:409353
Ig strand C 767..772 CDD:409353
Ig strand C' 775..777 CDD:409353
Ig strand D 783..788 CDD:409353
Ig strand E 791..796 CDD:409353
Ig strand F 805..813 CDD:409353
Ig strand G 816..826 CDD:409353
SPEG_u2 827..883 CDD:293256
IgI_APEG-1_like 884..974 CDD:409567
Ig strand B 901..905 CDD:409567
Ig strand C 914..918 CDD:409567
Ig strand E 940..944 CDD:409567
Ig strand F 954..959 CDD:409567
Ig strand G 967..970 CDD:409567
Ig 988..1073 CDD:416386
Ig strand A' 991..994 CDD:409353
Ig strand B 998..1007 CDD:409353
Ig strand C 1012..1018 CDD:409353
Ig strand C' 1021..1023 CDD:409353
Ig strand D 1030..1035 CDD:409353
Ig strand E 1038..1045 CDD:409353
Ig strand F 1053..1060 CDD:409353
Ig strand G 1063..1073 CDD:409353
Ig 1079..1168 CDD:416386
Ig strand A 1079..1082 CDD:409353
Ig strand A' 1085..1090 CDD:409353
Ig strand B 1095..1102 CDD:409353
Ig strand C 1109..1115 CDD:409353
Ig strand C' 1116..1119 CDD:409353
Ig strand D 1124..1130 CDD:409353
Ig strand E 1133..1143 CDD:409353
Ig strand F 1147..1155 CDD:409353
Ig strand G 1157..1168 CDD:409353
I-set 1203..1292 CDD:400151
Ig strand A 1203..1206 CDD:409353
Ig strand A' 1209..1214 CDD:409353
Ig strand B 1219..1226 CDD:409353
Ig strand C 1233..1239 CDD:409353
Ig strand C' 1240..1243 CDD:409353
Ig strand D 1248..1254 CDD:409353
Ig strand E 1257..1267 CDD:409353
Ig strand F 1271..1279 CDD:409353
Ig strand G 1281..1292 CDD:409353
I-set 1500..1589 CDD:400151
Ig strand A' 1508..1511 CDD:409353
Ig strand B 1515..1524 CDD:409353
Ig strand C 1529..1535 CDD:409353
Ig strand C' 1538..1540 CDD:409353
Ig strand D 1546..1551 CDD:409353
Ig strand E 1554..1561 CDD:409353
Ig strand F 1569..1576 CDD:409353
Ig strand G 1579..1589 CDD:409353
STKc_SPEG_rpt1 1613..1869 CDD:271010 95/259 (37%)
PHA03247 <1951..2352 CDD:223021 78/447 (17%)
I-set 2594..2684 CDD:400151
Ig strand A 2594..2596 CDD:409353
Ig strand A' 2599..2604 CDD:409353
Ig strand B 2611..2619 CDD:409353
Ig strand C 2624..2628 CDD:409353
Ig strand D 2639..2646 CDD:409353
Ig strand E 2649..2654 CDD:409353
Ig strand F 2663..2671 CDD:409353
Ig strand G 2674..2684 CDD:409353
PHA03247 <2785..2910 CDD:223021
PKc_like 2964..3220 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.