DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and stk17a

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001082806.1 Gene:stk17a / 327345 ZFINID:ZDB-GENE-030131-5556 Length:367 Species:Danio rerio


Alignment Length:374 Identity:126/374 - (33%)
Similarity:202/374 - (54%) Gaps:63/374 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MRDV-TINRNVDAHKHYDVL--GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREV 80
            :|:: |..|:....:.|||:  .|:|||||..|.||.:|::|.:.|||::    |:.::..:...
Zfish    27 LREIRTAIRSEPFTERYDVIPGKELGRGKFAVVRKCVEKSSGKEFAAKYM----RKRRKGQDCRT 87

  Fly    81 EIMNSLQHHL-----------IIQLYAAYEYQKMMCVVLELIEGGELFDR-VVDDEFVLTERVCR 133
            ||:    |.:           ::.|:..||....|.:|||...|||:|:: |.|.:...||:..:
Zfish    88 EII----HEIAVLELAAACPRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDEAFTEQEVK 148

  Fly   134 VFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQK--GNRIKIIDFGLARKFDPDKRLRVLFGTPE 196
            ..::|:.|.::|:|.|.:|||||||:|||:.::.  |: |||:||||:|.......:|.:.||||
Zfish   149 RLMKQILEGVSFLHNNNVVHLDLKPQNILLTSESPLGD-IKIVDFGLSRLLSNSHEVREIMGTPE 212

  Fly   197 FVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPE 261
            :|||||:|::.||..|||||:||:.||:::|:|||:|::..||..|::.....:.:|....:...
Zfish   213 YVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEHLDGS 277

  Fly   262 CLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSES 326
            .:.||..||.|:...|.||.:|:||:|||........:                ||||.|:.   
Zfish   278 AIRFIKSLLIKEPENRATAEDCLKHQWLQTEEQDLIES----------------SVSPGTSS--- 323

  Fly   327 SEDSTETIEDEDDEEEVAV----------QQAKQKDQQQDEELANLCGD 365
                    .||::|||:.|          |..:|||..:..:...|.||
Zfish   324 --------PDEEEEEELIVMAAYTLGQCRQTPEQKDVSKRFKFEELSGD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 102/270 (38%)
STKc_MLCK 40..289 CDD:271005 98/262 (37%)
stk17aNP_001082806.1 PKc_like 35..305 CDD:304357 103/278 (37%)
S_TKc 48..305 CDD:214567 99/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.